DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab3 and Rab3c

DIOPT Version :9

Sequence 1:NP_001356961.1 Gene:Rab3 / 36127 FlyBaseID:FBgn0005586 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_076341.1 Gene:Rab3c / 67295 MGIID:1914545 Length:227 Species:Mus musculus


Alignment Length:221 Identity:172/221 - (77%)
Similarity:193/221 - (87%) Gaps:3/221 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MASGGDPKW-QKDAADQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVF 64
            |||..|.:: |||::||||||||||||||||||||||||||||||||||||||||||||||||||
Mouse     9 MASAQDARFGQKDSSDQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVF 73

  Fly    65 RHDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEDSFNSVQDWVTQIKTYSWDNAQV 129
            :::||:||||||||||||||||||||||||||||||||:|||:|||:||||.|||||||||||||
Mouse    74 KNEKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQV 138

  Fly   130 ILVGNKCDMEDQRVISFERGRQLADQLGVEFFETSAKENVNVKAVFERLVDIICDKMSESLDADP 194
            ||.||||||||:||:|.|||::|.:|||.||||||||:|:|||..||||||||||||||||:.||
Mouse   139 ILAGNKCDMEDERVVSTERGQRLGEQLGFEFFETSAKDNINVKQTFERLVDIICDKMSESLETDP 203

  Fly   195 TLVGGGQKGQRLTDQPQGTPNANCNC 220
            .:....| ..||.:.|. .|..||.|
Mouse   204 AITAAKQ-STRLKETPP-PPQPNCGC 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab3NP_001356961.1 Rab3 21..185 CDD:206657 142/163 (87%)
Rab3cNP_076341.1 Rab3 30..194 CDD:206657 142/163 (87%)
Effector region. /evidence=ECO:0000250 59..67 7/7 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 202..227 9/26 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 292 1.000 Domainoid score I1513
eggNOG 1 0.900 - - E1_KOG0093
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H23420
Inparanoid 1 1.050 353 1.000 Inparanoid score I2242
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1218073at2759
OrthoFinder 1 1.000 - - FOG0000908
OrthoInspector 1 1.000 - - otm43103
orthoMCL 1 0.900 - - OOG6_105135
Panther 1 1.100 - - LDO PTHR47980
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2742
SonicParanoid 1 1.000 - - X578
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.860

Return to query results.
Submit another query.