Sequence 1: | NP_001356961.1 | Gene: | Rab3 / 36127 | FlyBaseID: | FBgn0005586 | Length: | 220 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001083031.1 | Gene: | rab8a / 571897 | ZFINID: | ZDB-GENE-070424-36 | Length: | 207 | Species: | Danio rerio |
Alignment Length: | 205 | Identity: | 98/205 - (47%) |
---|---|---|---|
Similarity: | 150/205 - (73%) | Gaps: | 5/205 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 16 QNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVFRHDKRVKLQIWDTAGQ 80
Fly 81 ERYRTITTAYYRGAMGFILMYDVTNEDSFNSVQDWVTQIKTYSWDNAQVILVGNKCDMEDQRVIS 145
Fly 146 FERGRQLADQLGVEFFETSAKENVNVKAVFERLVDIICDKMSESLDA-DPTLVGGGQKGQRL-TD 208
Fly 209 QPQGTPNANC 218 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Rab3 | NP_001356961.1 | Rab3 | 21..185 | CDD:206657 | 86/163 (53%) |
rab8a | NP_001083031.1 | Rab8_Rab10_Rab13_like | 6..172 | CDD:206659 | 88/165 (53%) |
RAB | 9..172 | CDD:197555 | 86/162 (53%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |