DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab3 and rab3da

DIOPT Version :9

Sequence 1:NP_001356961.1 Gene:Rab3 / 36127 FlyBaseID:FBgn0005586 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001139069.1 Gene:rab3da / 567288 ZFINID:ZDB-GENE-080722-14 Length:223 Species:Danio rerio


Alignment Length:224 Identity:168/224 - (75%)
Similarity:192/224 - (85%) Gaps:5/224 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MASGGDPKW----QKDAADQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVK 61
            |||..|.:.    |||.||||||||||||||||||||||||||||||||||||||||||||||||
Zfish     1 MASANDTRHQTQVQKDVADQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVK 65

  Fly    62 TVFRHDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEDSFNSVQDWVTQIKTYSWDN 126
            ||:|::||||||||||||||||||||||||||||||:||||:||:|||.:||||.||||||||||
Zfish    66 TVYRNEKRVKLQIWDTAGQERYRTITTAYYRGAMGFLLMYDITNQDSFYAVQDWATQIKTYSWDN 130

  Fly   127 AQVILVGNKCDMEDQRVISFERGRQLADQLGVEFFETSAKENVNVKAVFERLVDIICDKMSESLD 191
            |||||||||||:||.|:::.|.|::||::||.:|||.|||:|:|||.|||||||||||||:||||
Zfish   131 AQVILVGNKCDLEDDRLVAREDGQRLANELGFQFFEASAKDNINVKQVFERLVDIICDKMNESLD 195

  Fly   192 ADPTLVGGGQKGQRLTDQPQGTPNANCNC 220
            .||::: ..|||..|.|.|....:..|.|
Zfish   196 TDPSIL-TNQKGPSLQDTPPDGQSGGCGC 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab3NP_001356961.1 Rab3 21..185 CDD:206657 137/163 (84%)
rab3daNP_001139069.1 Rab3 25..189 CDD:206657 137/163 (84%)
RAB 26..186 CDD:197555 133/159 (84%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1218073at2759
OrthoFinder 1 1.000 - - FOG0000908
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47980
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X578
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
66.020

Return to query results.
Submit another query.