Sequence 1: | NP_001356961.1 | Gene: | Rab3 / 36127 | FlyBaseID: | FBgn0005586 | Length: | 220 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001313450.1 | Gene: | rab1aa / 566914 | ZFINID: | ZDB-GENE-090312-110 | Length: | 201 | Species: | Danio rerio |
Alignment Length: | 202 | Identity: | 89/202 - (44%) |
---|---|---|---|
Similarity: | 137/202 - (67%) | Gaps: | 7/202 - (3%) |
- Green bases have known domain annotations that are detailed below.
Fly 18 FDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVFRHDKRVKLQIWDTAGQER 82
Fly 83 YRTITTAYYRGAMGFILMYDVTNEDSFNSVQDWVTQIKTYSWDNAQVILVGNKCDMEDQRVISFE 147
Fly 148 RGRQLADQLGVEFFETSAKENVNVKAVFERLVDIICDKMSESLDADPTLVGGGQKGQ-RLTDQPQ 211
Fly 212 GTPNANC 218 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Rab3 | NP_001356961.1 | Rab3 | 21..185 | CDD:206657 | 80/163 (49%) |
rab1aa | NP_001313450.1 | Rab1_Ypt1 | 7..172 | CDD:206661 | 81/164 (49%) |
RAB | 9..172 | CDD:197555 | 80/162 (49%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |