DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab3 and rab3d

DIOPT Version :9

Sequence 1:NP_001356961.1 Gene:Rab3 / 36127 FlyBaseID:FBgn0005586 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001005621.1 Gene:rab3d / 448064 XenbaseID:XB-GENE-490391 Length:216 Species:Xenopus tropicalis


Alignment Length:221 Identity:164/221 - (74%)
Similarity:189/221 - (85%) Gaps:6/221 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MASGGDPKW-QKDAADQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVF 64
            |||..|.:. |||||||:||||||||||||||||||||||||||||||||||||||||||||||:
 Frog     1 MASANDTRQPQKDAADQSFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVY 65

  Fly    65 RHDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEDSFNSVQDWVTQIKTYSWDNAQV 129
            |::||||||||||||||||||||||||||||||:||||::|.:|||:||||.|||||||||||||
 Frog    66 RNEKRVKLQIWDTAGQERYRTITTAYYRGAMGFLLMYDISNLESFNAVQDWATQIKTYSWDNAQV 130

  Fly   130 ILVGNKCDMEDQRVISFERGRQLADQLGVEFFETSAKENVNVKAVFERLVDIICDKMSESLDADP 194
            :|||||||:||.|||..|.||:||::||.||||.|||:|:|||.||||||||||:||:|||:..|
 Frog   131 LLVGNKCDLEDDRVIPAEDGRKLAEELGFEFFEASAKDNINVKQVFERLVDIICEKMNESLENGP 195

  Fly   195 TLVGGGQKGQRLTDQPQGTPNANCNC 220
            ...|..|..:....:     ::||:|
 Frog   196 VPSGTAQLSESAPKE-----HSNCSC 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab3NP_001356961.1 Rab3 21..185 CDD:206657 139/163 (85%)
rab3dNP_001005621.1 Rab3 22..186 CDD:206657 139/163 (85%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 292 1.000 Domainoid score I1494
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 344 1.000 Inparanoid score I2269
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1218073at2759
OrthoFinder 1 1.000 - - FOG0000908
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47980
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2742
SonicParanoid 1 1.000 - - X578
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.100

Return to query results.
Submit another query.