DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab3 and rab35b

DIOPT Version :9

Sequence 1:NP_001356961.1 Gene:Rab3 / 36127 FlyBaseID:FBgn0005586 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001003548.1 Gene:rab35b / 445154 ZFINID:ZDB-GENE-040801-62 Length:201 Species:Danio rerio


Alignment Length:175 Identity:82/175 - (46%)
Similarity:132/175 - (75%) Gaps:1/175 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 QNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVFRHDKRVKLQIWDTAGQ 80
            :::|::|||||||:|.|||:|.|.|:||::|:.::::|:|:|||::||..:.::|||||||||||
Zfish     3 RDYDHLFKLLIIGDSGVGKSSLLLRFADNTFSGSYITTIGVDFKIRTVELNGEKVKLQIWDTAGQ 67

  Fly    81 ERYRTITTAYYRGAMGFILMYDVTNEDSFNSVQDWVTQIKTYSWDNAQVILVGNKCDMEDQRVIS 145
            ||:||||:.||||..|.:::||||:.:||.:|:.|:.:| ..:.|:...||||||.|..:.:|:.
Zfish    68 ERFRTITSTYYRGTHGVVVVYDVTSAESFVNVKRWLHEI-NQNCDDVCRILVGNKNDDPNSKVVE 131

  Fly   146 FERGRQLADQLGVEFFETSAKENVNVKAVFERLVDIICDKMSESL 190
            ....::.|:|:|:..|||||||||||:.:|..:.:::.....||:
Zfish   132 TNDAQKFAEQMGISLFETSAKENVNVEEMFNCITELVLRAKKESV 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab3NP_001356961.1 Rab3 21..185 CDD:206657 79/163 (48%)
rab35bNP_001003548.1 P-loop_NTPase 3..201 CDD:304359 82/175 (47%)
RAB 9..170 CDD:197555 79/161 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.