DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab3 and rab3aa

DIOPT Version :9

Sequence 1:NP_001356961.1 Gene:Rab3 / 36127 FlyBaseID:FBgn0005586 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001003419.1 Gene:rab3aa / 445024 ZFINID:ZDB-GENE-040801-2 Length:220 Species:Danio rerio


Alignment Length:222 Identity:167/222 - (75%)
Similarity:200/222 - (90%) Gaps:4/222 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MASGGDPKW-QKDAADQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVF 64
            |||..|.:: |||:|:||||||||:|||||||||||||||||||||||.||||||||||||||::
Zfish     1 MASANDARYGQKDSAEQNFDYMFKVLIIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTIY 65

  Fly    65 RHDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEDSFNSVQDWVTQIKTYSWDNAQV 129
            |:|||:||||||||||||||||||||||||||||||||:|||||||:||||.|||||||||||||
Zfish    66 RNDKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEDSFNAVQDWSTQIKTYSWDNAQV 130

  Fly   130 ILVGNKCDMEDQRVISFERGRQLADQLGVEFFETSAKENVNVKAVFERLVDIICDKMSESLD-AD 193
            :||||||||||:||::.:|||||::|||.||||.|||:|:|||..||||||:||::|||:|: ||
Zfish   131 LLVGNKCDMEDERVVAGQRGRQLSEQLGFEFFEASAKDNINVKQTFERLVDVICERMSENLESAD 195

  Fly   194 PTLVGGGQKGQRLTDQPQGTPNANCNC 220
            |::. |.:.|..|::|||.: :.:|.|
Zfish   196 PSMT-GNKLGPELSEQPQRS-HKDCAC 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab3NP_001356961.1 Rab3 21..185 CDD:206657 139/163 (85%)
rab3aaNP_001003419.1 Rab3 22..186 CDD:206657 139/163 (85%)
RAB 23..183 CDD:197555 136/159 (86%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 289 1.000 Domainoid score I1520
eggNOG 1 0.900 - - E1_KOG0093
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 346 1.000 Inparanoid score I2285
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1218073at2759
OrthoFinder 1 1.000 - - FOG0000908
OrthoInspector 1 1.000 - - otm25714
orthoMCL 1 0.900 - - OOG6_105135
Panther 1 1.100 - - O PTHR47980
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X578
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1211.830

Return to query results.
Submit another query.