DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab3 and Rab18

DIOPT Version :9

Sequence 1:NP_001356961.1 Gene:Rab3 / 36127 FlyBaseID:FBgn0005586 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_524744.2 Gene:Rab18 / 44360 FlyBaseID:FBgn0015794 Length:197 Species:Drosophila melanogaster


Alignment Length:165 Identity:67/165 - (40%)
Similarity:105/165 - (63%) Gaps:3/165 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 DYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVFRHDKRVKLQIWDTAGQERY 83
            |...|||:||.|.|||:|.:.|:.::.|......|:|:|||.|.:.......|:.:|||||.||:
  Fly     3 DRAIKLLVIGESGVGKSSLIRRFVENKFDQNHDVTIGMDFKSKVMQVDGIDYKVALWDTAGAERF 67

  Fly    84 RTITTAYYRGAMGFILMYDVTNEDSFNSVQDWVTQIKTYSWD-NAQVILVGNKCDMEDQRVISFE 147
            |::|.::||.|:|.||:||:|:.||...::.|:.::.:||.: |..:|:||||.|  ::||:..|
  Fly    68 RSLTPSFYRKALGAILVYDITSRDSLVKLETWLAELDSYSDNPNIAIIVVGNKID--EERVVDRE 130

  Fly   148 RGRQLADQLGVEFFETSAKENVNVKAVFERLVDII 182
            .||:.|.:....|.|||||.:..|..||:.:|:.|
  Fly   131 EGRKFARKHRALFIETSAKCDQFVSDVFKDVVEKI 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab3NP_001356961.1 Rab3 21..185 CDD:206657 66/163 (40%)
Rab18NP_524744.2 RAB 6..166 CDD:197555 66/162 (41%)
Rab18 6..165 CDD:206656 65/160 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454265
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.