DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab3 and Rab1

DIOPT Version :9

Sequence 1:NP_001356961.1 Gene:Rab3 / 36127 FlyBaseID:FBgn0005586 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_732610.1 Gene:Rab1 / 42524 FlyBaseID:FBgn0285937 Length:205 Species:Drosophila melanogaster


Alignment Length:208 Identity:86/208 - (41%)
Similarity:134/208 - (64%) Gaps:6/208 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 AADQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVFRHDKRVKLQIWDT 77
            :.:..:||:||||:||:|.|||:..|.|:|||::|.:::||:|:|||::|:....|.:|||||||
  Fly     3 SVNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDT 67

  Fly    78 AGQERYRTITTAYYRGAMGFILMYDVTNEDSFNSVQDWVTQIKTYSWDNAQVILVGNKCDMEDQR 142
            |||||:||||::|||||.|.|::||.|:::|||:|:.|:.:|:.|:.:|...:|||||.|:..::
  Fly    68 AGQERFRTITSSYYRGAHGIIVVYDCTDQESFNNVKQWLEEIERYACENVNKLLVGNKSDLTTKK 132

  Fly   143 VISFERGRQLADQLGVEFFETSAKENVNVKAVFERLVDIICDKMSESLDADPTLVGGGQKGQRLT 207
            |:......:.|.|||:.|.|||||...||:..|..:...|.:::.      |.........:...
  Fly   133 VVDHTTAAEYAAQLGIPFLETSAKSATNVEQAFMTMAAEIKNRVG------PPSSATDNASKVKI 191

  Fly   208 DQPQGTPNANCNC 220
            ||.:...|....|
  Fly   192 DQGRPVENTKSGC 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab3NP_001356961.1 Rab3 21..185 CDD:206657 79/163 (48%)
Rab1NP_732610.1 Rab1_Ypt1 10..175 CDD:206661 80/164 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454260
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.