DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab3 and Rab23

DIOPT Version :9

Sequence 1:NP_001356961.1 Gene:Rab3 / 36127 FlyBaseID:FBgn0005586 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_649574.1 Gene:Rab23 / 40701 FlyBaseID:FBgn0037364 Length:268 Species:Drosophila melanogaster


Alignment Length:188 Identity:62/188 - (32%)
Similarity:105/188 - (55%) Gaps:5/188 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 DQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVFRHDKRVKLQIWDTAG 79
            :.:.:...|::|:||..|||:|.:.||....||..:..|:|:||..:.:....:.|::.:|||||
  Fly    31 EDDIELAIKVVIVGNGGVGKSSMIQRYCKGIFTKDYKKTIGVDFLERQIEIDGEDVRIMLWDTAG 95

  Fly    80 QERYRTITTAYYRGAMGFILMYDVTNEDSFNSVQDWVTQIKTYSWDNAQVILVGNKCDMEDQRVI 144
            ||.:..||.||||||...:|::..|:..||::::||..:::. ..:....::|.||.|:.:|.|:
  Fly    96 QEEFDCITKAYYRGAQASVLVFSTTDRASFDAIKDWKRKVEN-ECNEIPTVIVQNKIDLIEQAVV 159

  Fly   145 SFERGRQLADQLGVEFFETSAKENVNVKAVFERLVDIICDKMSESLDADPTLVGGGQK 202
            :.:....||..|......||.||::||.:||..|.......|::|.|.    |.|.|:
  Fly   160 TADEVETLAKLLNCRLIRTSVKEDINVASVFRYLATKCHQLMTQSYDQ----VAGNQQ 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab3NP_001356961.1 Rab3 21..185 CDD:206657 56/163 (34%)
Rab23NP_649574.1 Ras 50..199 CDD:278499 50/149 (34%)
Rab23_like 50..197 CDD:133306 50/147 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454256
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.