DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab3 and Rab19

DIOPT Version :9

Sequence 1:NP_001356961.1 Gene:Rab3 / 36127 FlyBaseID:FBgn0005586 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001261575.1 Gene:Rab19 / 38930 FlyBaseID:FBgn0015793 Length:219 Species:Drosophila melanogaster


Alignment Length:214 Identity:81/214 - (37%)
Similarity:131/214 - (61%) Gaps:24/214 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 DQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVFRHDKRVKLQIWDTAG 79
            :::||::||:::||:...|||..:.|:...::.....:|:|:||.:||:....|::|||||||||
  Fly    15 EEHFDFLFKIVLIGDCGTGKTCIVDRFKTGNYIERHGNTIGVDFSMKTIAVEGKQIKLQIWDTAG 79

  Fly    80 QERYRTITTAYYRGAMGFILMYDVTNEDSFNSVQDWVTQIKTYSWDNAQVILVGNKCDMEDQRVI 144
            |||:||||.:|||.|.|.:::||:|...||:::|.|:.:::.|:..|..:||||||||:|:||.:
  Fly    80 QERFRTITQSYYRSANGVLIVYDITKRSSFSNLQKWIEEVRRYTASNVLIILVGNKCDLEEQREV 144

  Fly   145 SFERGRQLADQLGVEFF--ETSAKENVNVKAVFERLVDIICDKMSESLDA-------DPTLVGGG 200
            .||..||:...:....|  |||||||:||:..|.    .:.:::....||       :.|:..| 
  Fly   145 DFEEARQMCQYIPEILFVMETSAKENMNVEDAFR----CLANELKRQHDANNVEEVPENTITLG- 204

  Fly   201 QKGQRLTDQPQGTPNANCN 219
                      ||.|..:|:
  Fly   205 ----------QGKPLKSCS 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab3NP_001356961.1 Rab3 21..185 CDD:206657 71/165 (43%)
Rab19NP_001261575.1 Rab19 19..184 CDD:133267 72/168 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454138
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.