DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab3 and RabX5

DIOPT Version :9

Sequence 1:NP_001356961.1 Gene:Rab3 / 36127 FlyBaseID:FBgn0005586 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_647644.2 Gene:RabX5 / 38209 FlyBaseID:FBgn0035255 Length:277 Species:Drosophila melanogaster


Alignment Length:228 Identity:70/228 - (30%)
Similarity:113/228 - (49%) Gaps:46/228 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 KLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVK--TVFRHDKRVKLQIWDTAGQERYRT 85
            |::.:|:.|||||:.:.|:..|.|.|.:.:|:|:||:::  ::..|:  ..|::||||||||:|.
  Fly    66 KVIFVGDCSVGKTAIVNRFCYDKFQSNYKATIGVDFELENFSILGHN--YSLEMWDTAGQERFRC 128

  Fly    86 ITTAYYRGAMGFILMYDVTNEDSFNSVQDWVTQIKTYSWDNAQ----VILVGNKCD-MEDQRVIS 145
            |..||||.|...::.||::.:||..|.:.|:.....|   ||.    |.|||.|.| :..:..:.
  Fly   129 IAGAYYRNASVIVVTYDMSKKDSLESAKKWLNSALNY---NASKRPLVFLVGTKADLLSKEEFVR 190

  Fly   146 FERGRQL-ADQLGVEFFETSAKENVNVKAVFERLVDIICDK--MSE--SLDADPTLVGGGQK--- 202
            .||...| |.:|..|::..||:....|..:|:|:..:..::  |.|  |:...|      |:   
  Fly   191 MERLAGLAAAELQAEYWSVSARSGFKVTELFQRIAALAFEEAVMQEIRSIKNKP------QEQAT 249

  Fly   203 ---------------GQRLTDQPQGTPNANCNC 220
                           |.||:.|..|     |.|
  Fly   250 QASVKSQTFDLRNFFGSRLSQQKSG-----CTC 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab3NP_001356961.1 Rab3 21..185 CDD:206657 58/169 (34%)
RabX5NP_647644.2 P-loop_NTPase 66..230 CDD:304359 58/168 (35%)
RAB 66..225 CDD:197555 58/163 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454274
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.