DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab3 and Rab4

DIOPT Version :9

Sequence 1:NP_001356961.1 Gene:Rab3 / 36127 FlyBaseID:FBgn0005586 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_523777.1 Gene:Rab4 / 36992 FlyBaseID:FBgn0016701 Length:213 Species:Drosophila melanogaster


Alignment Length:216 Identity:81/216 - (37%)
Similarity:123/216 - (56%) Gaps:18/216 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 QNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVFRHDKRVKLQIWDTAGQ 80
            :.:||:||.||||::..||:..|..:.:..|......|:|::|..:.|....|.|||||||||||
  Fly     3 ETYDYLFKFLIIGSAGSGKSCLLHHFIESKFKDDSSHTIGVEFGSRIVNVGGKSVKLQIWDTAGQ 67

  Fly    81 ERYRTITTAYYRGAMGFILMYDVTNEDSFNSVQDWVTQIKTYSWDNAQVILVGNKCDMEDQRVIS 145
            ||:|::|.:|||||.|.:|:||.|:.||||::.:|:...:|.:..|..::|||||.|:|:.|.::
  Fly    68 ERFRSVTRSYYRGAAGALLVYDATSRDSFNALTNWLNDARTLASPNIVILLVGNKKDLEEARDVT 132

  Fly   146 FERGRQLADQLGVEFFETSAKENVNVKAVFERLVDIICDKMSESLDADPTLVGGG---------- 200
            |......|.:..:.|.|||||...||:..|.:....|..|: |:.:.||..:|.|          
  Fly   133 FLEASTFAQENELIFLETSAKTGENVEEAFLKCSKTILAKI-ETGELDPERIGSGIQYGGAALRN 196

  Fly   201 -QKGQRLTDQPQGTPNANCNC 220
             |..||..::|      :|.|
  Fly   197 LQTRQRSINKP------DCTC 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab3NP_001356961.1 Rab3 21..185 CDD:206657 67/163 (41%)
Rab4NP_523777.1 Rab4 9..169 CDD:206696 66/159 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454273
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.