DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab3 and Rab9

DIOPT Version :9

Sequence 1:NP_001356961.1 Gene:Rab3 / 36127 FlyBaseID:FBgn0005586 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_609966.1 Gene:Rab9 / 35221 FlyBaseID:FBgn0032782 Length:256 Species:Drosophila melanogaster


Alignment Length:160 Identity:55/160 - (34%)
Similarity:87/160 - (54%) Gaps:5/160 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 MFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVFRHDKRVKLQIWDTAGQERYRT 85
            :.|::|:|:..|||::.|.|:..:.:......|:|::|..|.:....:|..|||||||||||:|.
  Fly    12 LLKVVILGDGGVGKSALLTRFVANRYEENNFHTIGVEFMNKDIVVDGERYTLQIWDTAGQERFRA 76

  Fly    86 ITTAYYRGAMGFILMYDVTNEDSFNSVQDWVTQIKTYS---WDNAQVILVGNKCDMEDQ-RVISF 146
            :.|.:|||:...:|.|.:.:.||...:..|..:...|:   .|....|:||||.|:..| |.:|.
  Fly    77 LRTPFYRGSDICLLCYALDDRDSLKGLGVWRNEFLNYADVDQDKFPFIVVGNKNDIPAQKRQVSS 141

  Fly   147 ERGRQ-LADQLGVEFFETSAKENVNVKAVF 175
            :..:| .|:|......|||:|...||...|
  Fly   142 DAVQQWCAEQKVACHIETSSKAATNVTDAF 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab3NP_001356961.1 Rab3 21..185 CDD:206657 55/160 (34%)
Rab9NP_609966.1 Rab9 8..178 CDD:206697 55/160 (34%)
Ras 14..177 CDD:278499 55/158 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454269
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.