DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab3 and Rab21

DIOPT Version :9

Sequence 1:NP_001356961.1 Gene:Rab3 / 36127 FlyBaseID:FBgn0005586 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001036321.2 Gene:Rab21 / 3355163 FlyBaseID:FBgn0039966 Length:222 Species:Drosophila melanogaster


Alignment Length:175 Identity:69/175 - (39%)
Similarity:109/175 - (62%) Gaps:2/175 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 FKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVFRHD-KRVKLQIWDTAGQERYRT 85
            ||.:::|...|||||.:.||.:|.|.:..:||:...|..:.:...| :|.:|.|||||||||:..
  Fly    14 FKAVLLGEGCVGKTSLVLRYMEDRFNAQHLSTLQASFVSRKMSLEDGRRAQLNIWDTAGQERFHA 78

  Fly    86 ITTAYYRGAMGFILMYDVTNEDSFNSVQDWVTQIKTYSWDNAQVILVGNKCDMEDQRVISFERGR 150
            :...||||:.|.:|:||:|:.|||..|:.||.:::........:|:||||.|:|:||.::.:...
  Fly    79 LGPIYYRGSDGALLVYDITDRDSFQKVKSWVRELRQMRGTEIALIIVGNKTDLEEQRAVTHDEAL 143

  Fly   151 QLADQLGVEFFETSAKENVNVKAVFERLVDIICDKMSE-SLDADP 194
            |.|..:|.::.|||||||..|..:||.|..::.:::|: ..||.|
  Fly   144 QYARTVGAQYVETSAKENEGVAELFELLTQLMLEQLSQRQPDASP 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab3NP_001356961.1 Rab3 21..185 CDD:206657 65/163 (40%)
Rab21NP_001036321.2 Rab21 14..176 CDD:133323 65/161 (40%)
Ras 15..177 CDD:278499 64/161 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454266
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.