DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab3 and CG15399

DIOPT Version :9

Sequence 1:NP_001356961.1 Gene:Rab3 / 36127 FlyBaseID:FBgn0005586 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_608712.1 Gene:CG15399 / 33472 FlyBaseID:FBgn0031460 Length:242 Species:Drosophila melanogaster


Alignment Length:191 Identity:46/191 - (24%)
Similarity:72/191 - (37%) Gaps:59/191 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 KLLIIGNSSVGKTSFLFRYADDSFTSAFVS-TVGIDFKVKTVFRHD--KRVKL---QIWDTAG-- 79
            ::|::|:..|||||.....|....|....| |||.:.....|..|:  |.|.|   ..|.|..  
  Fly    13 RILMLGDRGVGKTSLTNLMATTEITPTPDSRTVGEESWHVQVRLHEYSKPVILPPTPTWTTPSSS 77

  Fly    80 --QERY----RTITT------------------------AYYRGAMGFILMYDVTNEDSFNSVQD 114
              .|.|    .|.||                        ::|:...|.:|:|::....|.:|:.|
  Fly    78 EDSENYPYMRSTPTTTNILYFVEFYDLNSDWRMCRQQRESFYKNIDGIVLVYNMLELSSQDSLHD 142

  Fly   115 WV----------------TQIKTYSWDNAQVILVGNKCDMEDQRVISFERGRQLADQLGVE 159
            |:                :.:|.:   ||.:::||...|...:|.:  .|...:|.||.||
  Fly   143 WLYDPLRQICKHRHLRIRSILKNH---NAPILVVGTNLDKLMRRPL--RRRGSIAHQLNVE 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab3NP_001356961.1 Rab3 21..185 CDD:206657 46/191 (24%)
CG15399NP_608712.1 P-loop_NTPase 12..229 CDD:304359 46/191 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR47980
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.