DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab3 and Rab40

DIOPT Version :9

Sequence 1:NP_001356961.1 Gene:Rab3 / 36127 FlyBaseID:FBgn0005586 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_727611.1 Gene:Rab40 / 32195 FlyBaseID:FBgn0030391 Length:265 Species:Drosophila melanogaster


Alignment Length:170 Identity:59/170 - (34%)
Similarity:95/170 - (55%) Gaps:13/170 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 QNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVS----------TVGIDFKVKTVFRHDKRV 70
            :::||:.|:|::|:|.|||...|....|.|..|.|.|          ||.  :|..|:....|||
  Fly     6 KDYDYLLKVLLVGDSDVGKHEILSNLEDPSTESPFCSGNDCTSHILQTVA--YKTTTILLEGKRV 68

  Fly    71 KLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEDSFNSVQDWVTQIKTYSWDNAQVILVGNK 135
            |||:|||:||.|:.||..:|.|||.|.||:||:||:.||:.:..|:.::..:: .....:||||:
  Fly    69 KLQLWDTSGQGRFCTIIRSYSRGAQGIILVYDITNKWSFDGIDRWLKEVDEHA-PGIPKVLVGNR 132

  Fly   136 CDMEDQRVISFERGRQLADQLGVEFFETSAKENVNVKAVF 175
            ..:..:|.::.::....|.:..:..||.|...|.|::..|
  Fly   133 LHLAFKRQVAAKQAETYASRNNMSCFEISPLCNFNIRESF 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab3NP_001356961.1 Rab3 21..185 CDD:206657 57/165 (35%)
Rab40NP_727611.1 P-loop_NTPase 6..265 CDD:304359 59/170 (35%)
RAB 12..182 CDD:197555 57/164 (35%)
SOCS 192..234 CDD:295349
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR47980
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.