DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab3 and Rab9Fb

DIOPT Version :9

Sequence 1:NP_001356961.1 Gene:Rab3 / 36127 FlyBaseID:FBgn0005586 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_727472.1 Gene:Rab9Fb / 32029 FlyBaseID:FBgn0052670 Length:214 Species:Drosophila melanogaster


Alignment Length:193 Identity:77/193 - (39%)
Similarity:121/193 - (62%) Gaps:3/193 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 FDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVFRHDKRVKLQIWDTAGQER 82
            :||:||:|::|:..|||:..|.|::|:.||...|.|||:||:|:.|....:.|.||||||||.||
  Fly     4 YDYLFKILVLGDIGVGKSCLLMRFSDNRFTEKHVCTVGMDFRVRNVELAGRMVMLQIWDTAGDER 68

  Fly    83 YRTITTAYYRGAMGFILMYDVTNEDSFNSVQDWVTQIKTYSWDNAQVILVGNKCDMEDQRVISFE 147
            ::::..:|||||.|.:|:||:|:..||.::..|:.:|:..|.::..|:|||||||..|.|.:..|
  Fly    69 FKSLLPSYYRGAHGILLVYDITSSKSFRNIDGWLKEIRRMSSESVNVMLVGNKCDDLDNRQVRME 133

  Fly   148 RGRQLADQLGVEFFETSAKENVNVKAVFERLVDIICDKMSESLDADPTLVGGGQKGQRLTDQP 210
            :|...|:...:.|:|.|||...||..||..|...|.:::   :...|..:.|||:.:...:.|
  Fly   134 QGFNYANHRALGFYEVSAKSGANVNDVFNMLSVGIYNRL---VIHTPNRLSGGQETEDTAEPP 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab3NP_001356961.1 Rab3 21..185 CDD:206657 70/163 (43%)
Rab9FbNP_727472.1 RAB 8..171 CDD:197555 70/162 (43%)
Rab 8..165 CDD:206640 68/156 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454254
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR47980
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.