DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab3 and Rab27

DIOPT Version :9

Sequence 1:NP_001356961.1 Gene:Rab3 / 36127 FlyBaseID:FBgn0005586 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_726743.1 Gene:Rab27 / 31103 FlyBaseID:FBgn0025382 Length:236 Species:Drosophila melanogaster


Alignment Length:174 Identity:74/174 - (42%)
Similarity:117/174 - (67%) Gaps:9/174 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 KLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVF------RHDKRVKLQIWDTAGQE 81
            :.|::|:|.||||..|::|.|..|.:.|:|||||||:.|.:.      ||  |:.||||||||||
  Fly    19 QFLVLGDSGVGKTCLLYQYTDGRFHTQFISTVGIDFREKRLLYNSRGRRH--RIHLQIWDTAGQE 81

  Fly    82 RYRTITTAYYRGAMGFILMYDVTNEDSFNSVQDWVTQIKTYSW-DNAQVILVGNKCDMEDQRVIS 145
            |:|::|||:||.||||:|::|:|:|.||....:|::|::|::: ::..|:|.|||||:...||:|
  Fly    82 RFRSLTTAFYRDAMGFLLIFDLTSEKSFLETANWLSQLRTHAYSEDPDVVLCGNKCDLLQLRVVS 146

  Fly   146 FERGRQLADQLGVEFFETSAKENVNVKAVFERLVDIICDKMSES 189
            .::...|..:..:.:.||||....|||...|.||..:.:::..:
  Fly   147 RDQVAALCRRYRLPYIETSACTGANVKEAVELLVGRVMERIENA 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab3NP_001356961.1 Rab3 21..185 CDD:206657 74/168 (44%)
Rab27NP_726743.1 P-loop_NTPase 19..187 CDD:304359 74/169 (44%)
RAB 20..186 CDD:197555 74/167 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454271
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.