DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab3 and RAB26

DIOPT Version :10

Sequence 1:NP_523687.1 Gene:Rab3 / 36127 FlyBaseID:FBgn0005586 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_055168.2 Gene:RAB26 / 25837 HGNCID:14259 Length:256 Species:Homo sapiens


Alignment Length:159 Identity:75/159 - (47%)
Similarity:110/159 - (69%) Gaps:1/159 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 FDYMFKLLIIGNSSVGKTSFLFRYADDSF-TSAFVSTVGIDFKVKTVFRHDKRVKLQIWDTAGQE 81
            :|..||::::|:|.||||..|.|:.|.:| ...|:|||||||:.|.:.....:||||:|||||||
Human    60 YDVAFKVMLVGDSGVGKTCLLVRFKDGAFLAGTFISTVGIDFRNKVLDVDGVKVKLQMWDTAGQE 124

  Fly    82 RYRTITTAYYRGAMGFILMYDVTNEDSFNSVQDWVTQIKTYSWDNAQVILVGNKCDMEDQRVISF 146
            |:|::|.||||.|...:|:|||||:.||:::|.|:|:|..|:..:..::|:|||.|...:||:..
Human   125 RFRSVTHAYYRDAHALLLLYDVTNKASFDNIQAWLTEIHEYAQHDVALMLLGNKVDSAHERVVKR 189

  Fly   147 ERGRQLADQLGVEFFETSAKENVNVKAVF 175
            |.|.:||.:.|:.|.|||||..:||...|
Human   190 EDGEKLAKEYGLPFMETSAKTGLNVDLAF 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab3NP_523687.1 Rab3 21..185 CDD:206657 74/156 (47%)
RAB26NP_055168.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..51
Rab26 64..254 CDD:206695 74/155 (48%)
Switch 1. /evidence=ECO:0000250|UniProtKB:P62820 86..101 7/14 (50%)
Switch 2. /evidence=ECO:0000250|UniProtKB:P62820 119..136 12/16 (75%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.