Sequence 1: | NP_001356961.1 | Gene: | Rab3 / 36127 | FlyBaseID: | FBgn0005586 | Length: | 220 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_075615.2 | Gene: | Rab8a / 17274 | MGIID: | 96960 | Length: | 207 | Species: | Mus musculus |
Alignment Length: | 205 | Identity: | 100/205 - (48%) |
---|---|---|---|
Similarity: | 149/205 - (72%) | Gaps: | 3/205 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 16 QNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVFRHDKRVKLQIWDTAGQ 80
Fly 81 ERYRTITTAYYRGAMGFILMYDVTNEDSFNSVQDWVTQIKTYSWDNAQVILVGNKCDMEDQRVIS 145
Fly 146 FERGRQLADQLGVEFFETSAKENVNVKAVFERLVDIICDKMSESLDADPTLVGGGQKGQRLT-DQ 209
Fly 210 PQGTPNANCN 219 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Rab3 | NP_001356961.1 | Rab3 | 21..185 | CDD:206657 | 89/163 (55%) |
Rab8a | NP_075615.2 | Rab8_Rab10_Rab13_like | 6..172 | CDD:206659 | 91/165 (55%) |
Effector region. /evidence=ECO:0000250 | 37..45 | 5/7 (71%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |