DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab3 and Rab8a

DIOPT Version :9

Sequence 1:NP_001356961.1 Gene:Rab3 / 36127 FlyBaseID:FBgn0005586 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_075615.2 Gene:Rab8a / 17274 MGIID:96960 Length:207 Species:Mus musculus


Alignment Length:205 Identity:100/205 - (48%)
Similarity:149/205 - (72%) Gaps:3/205 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 QNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVFRHDKRVKLQIWDTAGQ 80
            :.:||:||||:||:|.||||..|||:::|:|.|.|:||:|||||::|:....||:||||||||||
Mouse     3 KTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQ 67

  Fly    81 ERYRTITTAYYRGAMGFILMYDVTNEDSFNSVQDWVTQIKTYSWDNAQVILVGNKCDMEDQRVIS 145
            ||:|||||||||||||.:|:||:|||.||:::::|:..|:.::..:.:.:::|||||:.|:|.:|
Mouse    68 ERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVS 132

  Fly   146 FERGRQLADQLGVEFFETSAKENVNVKAVFERLVDIICDKMSESLDADPTLVGGGQKGQRLT-DQ 209
            .|||.:||...|::|.|||||.|:||:..|..|...|..||.:.|:.:..  .|...|.::| :|
Mouse   133 KERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGNSP--QGSSHGVKITVEQ 195

  Fly   210 PQGTPNANCN 219
            .:.|....|:
Mouse   196 QKRTSFFRCS 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab3NP_001356961.1 Rab3 21..185 CDD:206657 89/163 (55%)
Rab8aNP_075615.2 Rab8_Rab10_Rab13_like 6..172 CDD:206659 91/165 (55%)
Effector region. /evidence=ECO:0000250 37..45 5/7 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.