Sequence 1: | NP_001356961.1 | Gene: | Rab3 / 36127 | FlyBaseID: | FBgn0005586 | Length: | 220 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001092729.1 | Gene: | rab8b / 100093706 | ZFINID: | ZDB-GENE-070620-16 | Length: | 209 | Species: | Danio rerio |
Alignment Length: | 200 | Identity: | 94/200 - (47%) |
---|---|---|---|
Similarity: | 146/200 - (73%) | Gaps: | 0/200 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 16 QNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVFRHDKRVKLQIWDTAGQ 80
Fly 81 ERYRTITTAYYRGAMGFILMYDVTNEDSFNSVQDWVTQIKTYSWDNAQVILVGNKCDMEDQRVIS 145
Fly 146 FERGRQLADQLGVEFFETSAKENVNVKAVFERLVDIICDKMSESLDADPTLVGGGQKGQRLTDQP 210
Fly 211 QGTPN 215 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Rab3 | NP_001356961.1 | Rab3 | 21..185 | CDD:206657 | 87/163 (53%) |
rab8b | NP_001092729.1 | Rab8_Rab10_Rab13_like | 6..172 | CDD:206659 | 89/165 (54%) |
RAB | 9..172 | CDD:197555 | 87/162 (54%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |