DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH13 and ACA7

DIOPT Version :10

Sequence 1:NP_610602.2 Gene:CAH13 / 36126 FlyBaseID:FBgn0033542 Length:527 Species:Drosophila melanogaster
Sequence 2:NP_172287.1 Gene:ACA7 / 837326 AraportID:AT1G08080 Length:275 Species:Arabidopsis thaliana


Alignment Length:64 Identity:15/64 - (23%)
Similarity:27/64 - (42%) Gaps:8/64 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 EEALAAGKAVKEAGLKFDIAHT----SLLTRAQVTLDSILKESGQTSIPI--QKTW--RLNERH 92
            |:.|.:.:.|.|...:..:..|    ..|...||:|:.:...:.:||:..  :..|  ||...|
plant    46 EDELVSEEKVMEGRRRIKVVITRKQLDRLLAKQVSLEQLAFVNQRTSLSCFDESKWIPRLESIH 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH13NP_610602.2 alpha_CARP_receptor_like 90..339 CDD:239396 1/3 (33%)
ACA7NP_172287.1 alpha_CA_prokaryotic_like 49..270 CDD:239398 14/61 (23%)

Return to query results.
Submit another query.