DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Elp2 and SEC12

DIOPT Version :9

Sequence 1:NP_610600.1 Gene:Elp2 / 36123 FlyBaseID:FBgn0033540 Length:794 Species:Drosophila melanogaster
Sequence 2:NP_014423.1 Gene:SEC12 / 855760 SGDID:S000005309 Length:471 Species:Saccharomyces cerevisiae


Alignment Length:202 Identity:37/202 - (18%)
Similarity:76/202 - (37%) Gaps:43/202 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   580 ASNAEHAQIILWNPSNWKQIQKLSGHQLTVTQLSFSPDSRYLLSVSRDR---------RWCLYER 635
            |||.....::.....:..:|.| ..|...:|:::.||||.|:.|||...         .:..|..
Yeast   284 ASNDNSIALVKLKDLSMSKIFK-QAHSFAITEVTISPDSTYVASVSAANTIHIIKLPLNYANYTS 347

  Fly   636 QDSSVS-----------YQLVASTDKSNGVHTRIIWSCDWSHDGQFFVTSSRDGKVVVWKKEEDC 689
            ....:|           ...:......:.:|:.:.   :::.|.  |:| .||.....:..:||.
Yeast   348 MKQKISKFFTNFILIVLLSYILQFSYKHNLHSMLF---NYAKDN--FLT-KRDTISSPYVVDEDL 406

  Fly   690 KESSLNGWQANGVLELKNESITAV----AFSNSYLSGTDDTYILALGTETGLIKI----YQFVRG 746
            .:::|.|   |...:....|:.::    ....|.::||:     .|.||:.:|..    ::....
Yeast   407 HQTTLFG---NHGTKTSVPSVDSIKVHGVHETSSVNGTE-----VLCTESNIINTGGAEFEITNA 463

  Fly   747 AWKLLSD 753
            .::.:.|
Yeast   464 TFREIDD 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Elp2NP_610600.1 WD40 <2..236 CDD:225201
WD40 repeat 18..55 CDD:293791
WD40 50..412 CDD:295369
WD40 repeat 104..145 CDD:293791
WD40 repeat 150..202 CDD:293791
WD40 repeat 209..281 CDD:293791
WD40 237..741 CDD:225201 36/188 (19%)
WD40 repeat 291..331 CDD:293791
WD40 repeat 337..382 CDD:293791
WD40 repeat 389..412 CDD:293791
WD40 552..790 CDD:295369 37/202 (18%)
WD40 repeat 563..604 CDD:293791 5/23 (22%)
WD40 repeat 609..652 CDD:293791 11/62 (18%)
WD40 repeat 660..695 CDD:293791 7/34 (21%)
WD40 repeat 702..758 CDD:293791 9/60 (15%)
WD40 repeat 764..791 CDD:293791
SEC12NP_014423.1 WD40 79..>335 CDD:225201 15/51 (29%)
WD40 repeat 177..212 CDD:293791
WD40 repeat 219..258 CDD:293791
WD40 repeat 270..305 CDD:293791 4/20 (20%)
WD40 repeat 312..360 CDD:293791 11/47 (23%)
WD40 repeat 368..431 CDD:293791 12/71 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157341401
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.