DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Elp2 and ciao1

DIOPT Version :9

Sequence 1:NP_610600.1 Gene:Elp2 / 36123 FlyBaseID:FBgn0033540 Length:794 Species:Drosophila melanogaster
Sequence 2:NP_956441.2 Gene:ciao1 / 795104 ZFINID:ZDB-GENE-040426-839 Length:330 Species:Danio rerio


Alignment Length:354 Identity:78/354 - (22%)
Similarity:126/354 - (35%) Gaps:99/354 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 NRCTECADWGPNG--WIAYGACNAIAIMDPKFQGNSAKVLFTLVE-HTKRVNTVRWLDCDK-LLS 73
            :||...| |.|.|  ....|...||.|...  :|:|.:....|.: |.:.|..|.|..|.| |.|
Zfish    17 SRCWYVA-WNPAGTTLATCGGDRAIRIWGK--EGDSWECKCVLSDGHQRTVRKVAWSPCGKYLAS 78

  Fly    74 GGDDAIAILWELDETGTTKSFTLKGHTSGVNTVDGIRQQDGSW-----LLATAAADTTIKLWTF- 132
            ...||...:|:..:........|:||.:.|..|        :|     ||||.:.|.::.:|.. 
Zfish    79 ASFDATTCIWKKTDEDFECLTVLEGHENEVKCV--------AWAPSGSLLATCSRDKSVWIWEVD 135

  Fly   133 QDNNYVCFQTIS--LSDGFCFCLRLQLLPKSNQVLLAFSGDDETVSLWSEQVETAGEGDSLGRQF 195
            :::.|.|...::  ..|      ...::....|.|||.:..|..:.::.|:.:          .:
Zfish   136 EEDEYECLSVVNSHTQD------VKHVVWHPTQELLASASYDNKICIYKEEDD----------DW 184

  Fly   196 QRKHKLTGHEDWVRGLDFVVDGEDLLLASGSQDNFIRLWRIAPRSKEQMQENRVDLHQLSHNDDE 260
            :.:..|.|||..|..|.|  |.|...|||.|.|..:::|:                 :.:..|..
Zfish   185 ECRATLEGHESTVWSLTF--DPEGRRLASCSDDRTVKIWK-----------------ESTTGDGS 230

  Fly   261 IKVEEKILQLGKEAWYAVSLESVLYGHEGWIYGVHWHK-----------------------TPDQ 302
                      ..|:|..:...|..:|..  ||.:.|.:                       .|:|
Zfish   231 ----------SDESWKCICTLSGFHGRT--IYDIAWCRLTGALATACGDDGVRVFSEDPTADPEQ 283

  Fly   303 ELRLLSASI------DKTVIIWAPTEEGI 325
            .:..|||.:      |...:.|.|.|.|:
Zfish   284 PIFALSAHVPKAHNQDVNCVSWNPKEAGL 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Elp2NP_610600.1 WD40 <2..236 CDD:225201 60/234 (26%)
WD40 repeat 18..55 CDD:293791 11/38 (29%)
WD40 50..412 CDD:295369 66/315 (21%)
WD40 repeat 104..145 CDD:293791 10/48 (21%)
WD40 repeat 150..202 CDD:293791 6/51 (12%)
WD40 repeat 209..281 CDD:293791 13/71 (18%)
WD40 237..741 CDD:225201 18/118 (15%)
WD40 repeat 291..331 CDD:293791 13/64 (20%)
WD40 repeat 337..382 CDD:293791
WD40 repeat 389..412 CDD:293791
WD40 552..790 CDD:295369
WD40 repeat 563..604 CDD:293791
WD40 repeat 609..652 CDD:293791
WD40 repeat 660..695 CDD:293791
WD40 repeat 702..758 CDD:293791
WD40 repeat 764..791 CDD:293791
ciao1NP_956441.2 WD 1 14..53 12/38 (32%)
WD40 repeat 19..59 CDD:293791 12/42 (29%)
WD40 22..>329 CDD:225201 76/349 (22%)
WD40 22..326 CDD:238121 76/349 (22%)
WD 2 59..98 11/38 (29%)
WD40 repeat 65..103 CDD:293791 10/37 (27%)
WD 3 103..142 12/46 (26%)
WD40 repeat 108..147 CDD:293791 11/46 (24%)
WD 4 148..187 7/54 (13%)
WD40 repeat 154..191 CDD:293791 6/46 (13%)
WD 5 192..231 15/67 (22%)
WD40 repeat 197..242 CDD:293791 14/73 (19%)
WD 6 244..283 5/40 (13%)
WD40 repeat 249..289 CDD:293791 5/39 (13%)
WD 7 295..330 5/18 (28%)
WD40 repeat 300..325 CDD:293791 4/13 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.