DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Elp2 and Ciao1

DIOPT Version :9

Sequence 1:NP_610600.1 Gene:Elp2 / 36123 FlyBaseID:FBgn0033540 Length:794 Species:Drosophila melanogaster
Sequence 2:NP_610996.1 Gene:Ciao1 / 36655 FlyBaseID:FBgn0033972 Length:335 Species:Drosophila melanogaster


Alignment Length:354 Identity:81/354 - (22%)
Similarity:138/354 - (38%) Gaps:92/354 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 WGPNGWIAYGAC---NAIAIMDPKFQGNSAKVLFTLVE-HTKRVNTVRWLDCDK-LLSGGDDAIA 80
            |.|.|.: :.:|   .||.|.  ...||:......|.: |.:.:..:||..|.: |.|...||..
  Fly    22 WHPKGNV-FASCGEDKAIRIW--SLTGNTWSTKTILSDGHKRTIREIRWSPCGQYLASASFDATT 83

  Fly    81 ILWELDETGTTKSFTLKGHTSGVNTVDGIRQQDGSW-----LLATAAADTTIKLWTFQ-DNNYVC 139
            .:|.........:.||:||.:.|.:|        ||     ||||.:.|.::.:|... |:.:.|
  Fly    84 AIWSKSSGEFECNATLEGHENEVKSV--------SWSRSGGLLATCSRDKSVWIWEVAGDDEFEC 140

  Fly   140 FQTISLSDGFCFCLRLQLLPKSNQV----------LLAFSGDDETVSLWSEQVETAGEGDSLGRQ 194
            ...::              |.:..|          :||.:..|.|:.:::|        :.:...
  Fly   141 AAVLN--------------PHTQDVKRVVWHPTKDILASASYDNTIKMFAE--------EPIDND 183

  Fly   195 FQRKHKLTGHEDWVRGLDFVVDGEDLLLASGSQDNFIRLWR---------IAPRSKEQM------ 244
            :.....||.|...|.|:||..|||.|:  |.|.|..|::||         :|...::.:      
  Fly   184 WDCTATLTSHTSTVWGIDFDADGERLV--SCSDDTTIKIWRAYHPGNTAGVATPDQQTVWKCVCT 246

  Fly   245 ---QENRVDLHQLSH-----------NDDEIKV--EEKILQLGKEAWYAVSLESVLYGHEGWIYG 293
               |.:|. ::.:|.           .||.|::  |....:..:..:..::.|.  ..|:..:..
  Fly   247 VSGQHSRA-IYDVSWCKLTGLIATACGDDGIRIFKESSDSKPDEPTFEQITAEE--GAHDQDVNS 308

  Fly   294 VHWHKTPDQELRLLSASIDKTVIIWAPTE 322
            |.|:  |....:|:|.|.|.|:.||..||
  Fly   309 VQWN--PVVAGQLISCSDDGTIKIWKVTE 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Elp2NP_610600.1 WD40 <2..236 CDD:225201 59/244 (24%)
WD40 repeat 18..55 CDD:293791 10/36 (28%)
WD40 50..412 CDD:295369 72/322 (22%)
WD40 repeat 104..145 CDD:293791 11/46 (24%)
WD40 repeat 150..202 CDD:293791 7/61 (11%)
WD40 repeat 209..281 CDD:293791 21/102 (21%)
WD40 237..741 CDD:225201 22/108 (20%)
WD40 repeat 291..331 CDD:293791 12/32 (38%)
WD40 repeat 337..382 CDD:293791
WD40 repeat 389..412 CDD:293791
WD40 552..790 CDD:295369
WD40 repeat 563..604 CDD:293791
WD40 repeat 609..652 CDD:293791
WD40 repeat 660..695 CDD:293791
WD40 repeat 702..758 CDD:293791
WD40 repeat 764..791 CDD:293791
Ciao1NP_610996.1 WD40 6..332 CDD:238121 78/349 (22%)
WD40 9..>333 CDD:225201 79/350 (23%)
WD40 repeat 17..57 CDD:293791 10/37 (27%)
WD40 repeat 63..101 CDD:293791 10/37 (27%)
WD40 repeat 106..145 CDD:293791 12/46 (26%)
WD40 repeat 152..191 CDD:293791 5/46 (11%)
WD40 repeat 197..248 CDD:293791 15/52 (29%)
WD40 repeat 255..299 CDD:293791 5/43 (12%)
WD40 repeat 306..331 CDD:293791 8/26 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0645
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.