Sequence 1: | NP_610600.1 | Gene: | Elp2 / 36123 | FlyBaseID: | FBgn0033540 | Length: | 794 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_079572.2 | Gene: | Ciao1 / 26371 | MGIID: | 1346998 | Length: | 339 | Species: | Mus musculus |
Alignment Length: | 237 | Identity: | 69/237 - (29%) |
---|---|---|---|
Similarity: | 104/237 - (43%) | Gaps: | 49/237 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 565 LAATADGSLLASTCKASNAEHAQIILWNP--SNWKQIQKLS-GHQLTVTQLSFSPDSRYLLSVSR 626
Fly 627 DRRWCLYER-QDSSVSYQLVASTDKSNGVHTRIIWSCDWSHDGQFFVTSSRDGKVVVWKKEEDCK 690
Fly 691 ESSLNGWQANGVLELKNESITAVAF--------SNSYLSGTDDTYILALGTETGLIKIYQFVRGA 747
Fly 748 WKLLSDLNKSQAHHLTVRRLQFRPGKQLQLASCGEDHLVRIY 789 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Elp2 | NP_610600.1 | WD40 | <2..236 | CDD:225201 | |
WD40 repeat | 18..55 | CDD:293791 | |||
WD40 | 50..412 | CDD:295369 | |||
WD40 repeat | 104..145 | CDD:293791 | |||
WD40 repeat | 150..202 | CDD:293791 | |||
WD40 repeat | 209..281 | CDD:293791 | |||
WD40 | 237..741 | CDD:225201 | 51/187 (27%) | ||
WD40 repeat | 291..331 | CDD:293791 | |||
WD40 repeat | 337..382 | CDD:293791 | |||
WD40 repeat | 389..412 | CDD:293791 | |||
WD40 | 552..790 | CDD:295369 | 69/237 (29%) | ||
WD40 repeat | 563..604 | CDD:293791 | 13/41 (32%) | ||
WD40 repeat | 609..652 | CDD:293791 | 12/43 (28%) | ||
WD40 repeat | 660..695 | CDD:293791 | 11/34 (32%) | ||
WD40 repeat | 702..758 | CDD:293791 | 14/63 (22%) | ||
WD40 repeat | 764..791 | CDD:293791 | 12/26 (46%) | ||
Ciao1 | NP_079572.2 | WD 1 | 14..53 | 11/35 (31%) | |
WD40 | 17..332 | CDD:238121 | 69/237 (29%) | ||
WD40 repeat | 19..58 | CDD:293791 | 12/40 (30%) | ||
WD 2 | 59..98 | 15/41 (37%) | |||
WD40 repeat | 65..103 | CDD:293791 | 11/40 (28%) | ||
WD 3 | 103..142 | 12/48 (25%) | |||
WD40 repeat | 108..147 | CDD:293791 | 12/44 (27%) | ||
WD 4 | 148..187 | 11/53 (21%) | |||
WD40 repeat | 154..191 | CDD:293791 | 12/54 (22%) | ||
LYR motif, required for interaction with HSC20. /evidence=ECO:0000250|UniProtKB:O76071 | 176..178 | 0/1 (0%) | |||
WD 5 | 192..231 | 14/31 (45%) | |||
WD40 repeat | 197..248 | CDD:293791 | 12/26 (46%) | ||
WD 6 | 250..289 | ||||
WD40 repeat | 255..295 | CDD:293791 | |||
WD 7 | 301..339 | ||||
WD40 repeat | 306..331 | CDD:293791 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0645 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |