Sequence 1: | NP_610599.3 | Gene: | Git / 36122 | FlyBaseID: | FBgn0033539 | Length: | 731 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001137472.1 | Gene: | AGAP5 / 729092 | HGNCID: | 23467 | Length: | 686 | Species: | Homo sapiens |
Alignment Length: | 236 | Identity: | 68/236 - (28%) |
---|---|---|---|
Similarity: | 105/236 - (44%) | Gaps: | 31/236 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 49 CGDCGAGDPSWASINRGILLCADCCSVHRSLGRHISIVKSLRQGNWEPSVLNFVNSLNAHGANSV 113
Fly 114 WEHHLLDGSTNSTGGKHVPRWRKPTPKDALHPTKSDFIKAKHVNLTFVLKPSLQDDDDGNGSAGC 178
Fly 179 LEQELSRQLHASVRTSNLETSLRFLVQGADPNYYH---EDKLSTPLHMAAKFGQASQIEMLLIYG 240
Fly 241 ADVNALDGNGMTPLELARANNHNTIAERLLDAMYDVTDRII 281 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Git | NP_610599.3 | ArfGap | 48..164 | CDD:279720 | 37/114 (32%) |
Ank_2 | 187..279 | CDD:289560 | 26/94 (28%) | ||
ANK | <187..270 | CDD:238125 | 23/85 (27%) | ||
ANK repeat | 187..213 | CDD:293786 | 5/25 (20%) | ||
ANK repeat | 215..247 | CDD:293786 | 11/31 (35%) | ||
ANK repeat | 249..279 | CDD:293786 | 8/29 (28%) | ||
GIT_SHD | 314..342 | CDD:285690 | |||
GIT | 374..404 | CDD:128828 | |||
GIT1_C | 609..727 | CDD:289013 | |||
AGAP5 | NP_001137472.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 205..242 | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 256..278 | ||||
PH_AGAP | 280..447 | CDD:241281 | |||
PH | 283..442 | CDD:278594 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 382..404 | ||||
ArfGap | 466..580 | CDD:279720 | 38/126 (30%) | ||
ANK | <590..677 | CDD:238125 | 23/86 (27%) | ||
Ank_2 | 591..681 | CDD:289560 | 26/91 (29%) | ||
ANK repeat | 591..621 | CDD:293786 | 5/29 (17%) | ||
ANK repeat | 623..654 | CDD:293786 | 11/30 (37%) | ||
ANK 1 | 623..652 | 10/28 (36%) | |||
ANK 2 | 656..685 | 9/30 (30%) | |||
ANK repeat | 656..681 | CDD:293786 | 8/26 (31%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5347 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |