powered by:
Protein Alignment Git and smap2
DIOPT Version :9
Sequence 1: | NP_610599.3 |
Gene: | Git / 36122 |
FlyBaseID: | FBgn0033539 |
Length: | 731 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001038260.1 |
Gene: | smap2 / 556132 |
ZFINID: | ZDB-GENE-060503-374 |
Length: | 418 |
Species: | Danio rerio |
Alignment Length: | 74 |
Identity: | 28/74 - (37%) |
Similarity: | 38/74 - (51%) |
Gaps: | 0/74 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 45 QTEVCGDCGAGDPSWASINRGILLCADCCSVHRSLGRHISIVKSLRQGNWEPSVLNFVNSLNAHG 109
:.:.|.||.|..|.|||.|.||.:|..|..:||:||.|||.|||:....|....:..|..:....
Zfish 24 ENKFCADCYAKGPRWASWNLGIFICIRCAGIHRNLGVHISRVKSVNLDQWTQEQIQSVQEMGNAK 88
Fly 110 ANSVWEHHL 118
|..::|..|
Zfish 89 ARRLYEAFL 97
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5347 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.