DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Git and smap2

DIOPT Version :9

Sequence 1:	NP_610599.3	Gene:	Git / 36122	FlyBaseID:	FBgn0033539	Length:	731	Species:	Drosophila melanogaster
Sequence 2:	NP_001038260.1	Gene:	smap2 / 556132	ZFINID:	ZDB-GENE-060503-374	Length:	418	Species:	Danio rerio

Alignment Length:	74	Identity:	28/74 - (37%)
Similarity:	38/74 - (51%)	Gaps:	0/74 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly    45 QTEVCGDCGAGDPSWASINRGILLCADCCSVHRSLGRHISIVKSLRQGNWEPSVLNFVNSLNAHG 109
            :.:.|.||.|..|.|||.|.||.:|..|..:||:||.|||.|||:....|....:..|..:....
Zfish    24 ENKFCADCYAKGPRWASWNLGIFICIRCAGIHRNLGVHISRVKSVNLDQWTQEQIQSVQEMGNAK 88

  Fly   110 ANSVWEHHL 118
            |..::|..|
Zfish    89 ARRLYEAFL 97

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Git	NP_610599.3	ArfGap	48..164	CDD:279720	28/71 (39%)
		Ank_2	187..279	CDD:289560
		ANK	<187..270	CDD:238125
		ANK repeat	187..213	CDD:293786
		ANK repeat	215..247	CDD:293786
		ANK repeat	249..279	CDD:293786
		GIT_SHD	314..342	CDD:285690
		GIT	374..404	CDD:128828
		GIT1_C	609..727	CDD:289013
smap2	NP_001038260.1	COG5347	13..>275	CDD:227651	28/74 (38%)
smap2	NP_001038260.1	ArfGap	13..115	CDD:279720	28/74 (38%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG5347
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.900