| Sequence 1: | NP_610599.3 | Gene: | Git / 36122 | FlyBaseID: | FBgn0033539 | Length: | 731 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001002715.1 | Gene: | zgc:92360 / 436988 | ZFINID: | ZDB-GENE-040718-470 | Length: | 377 | Species: | Danio rerio |
| Alignment Length: | 195 | Identity: | 55/195 - (28%) |
|---|---|---|---|
| Similarity: | 81/195 - (41%) | Gaps: | 46/195 - (23%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 49 CGDCGAGDPSWASINRGILLCADCCSVHRSLGRHISIVKSLRQGNWEPSVLNFVNSLNAHGANSV 113
Fly 114 WEHHLLDGSTNSTGGKHVP-RWRKPTPKDALHPTKSDFIKAKHVNLTFV---LKPSLQDDD-DG- 172
Fly 173 -------NGSAGCLEQELSRQLHASVRTSNLETSLRFLVQGADPN----------YYHEDKLSTP 220
Fly 221 220 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Git | NP_610599.3 | ArfGap | 48..164 | CDD:279720 | 38/118 (32%) |
| Ank_2 | 187..279 | CDD:289560 | 8/44 (18%) | ||
| ANK | <187..270 | CDD:238125 | 8/44 (18%) | ||
| ANK repeat | 187..213 | CDD:293786 | 5/35 (14%) | ||
| ANK repeat | 215..247 | CDD:293786 | 3/6 (50%) | ||
| ANK repeat | 249..279 | CDD:293786 | |||
| GIT_SHD | 314..342 | CDD:285690 | |||
| GIT | 374..404 | CDD:128828 | |||
| GIT1_C | 609..727 | CDD:289013 | |||
| zgc:92360 | NP_001002715.1 | ArfGap | 8..124 | CDD:279720 | 38/115 (33%) |
| PH1_ADAP | 132..240 | CDD:270072 | 15/71 (21%) | ||
| PH | 134..230 | CDD:278594 | 15/69 (22%) | ||
| PH2_ADAP | 254..359 | CDD:241282 | |||
| PH | 257..358 | CDD:278594 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG5347 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||