DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Git and AGAP6

DIOPT Version :9

Sequence 1:NP_610599.3 Gene:Git / 36122 FlyBaseID:FBgn0033539 Length:731 Species:Drosophila melanogaster
Sequence 2:NP_001071133.2 Gene:AGAP6 / 414189 HGNCID:23466 Length:686 Species:Homo sapiens


Alignment Length:236 Identity:71/236 - (30%)
Similarity:108/236 - (45%) Gaps:31/236 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 CGDCGAGDPSWASINRGILLCADCCSVHRSLGRHISIVKSLRQGNWEPSVLNFVNSLNAHGANSV 113
            |.||...:|.|||:|.|:|:|.:|..:|||||.|:|.|:||...:|...:...::|:....|||:
Human   479 CVDCETQNPKWASLNLGVLMCIECSGIHRSLGPHLSRVRSLELDDWPVELRKVMSSIVNDLANSI 543

  Fly   114 WEHHLLDGSTNSTGGKHVPRWRKPTPKDALHPTKSDFIKAKHVNLTFVLKPSLQDDDDGNGSAGC 178
            ||        .|:.|:     .||:.| :....|..:|::|:....| |.|           ..|
Human   544 WE--------GSSQGQ-----TKPSEK-STREEKERWIRSKYEEKLF-LAP-----------LPC 582

  Fly   179 LEQELSRQLHASVRTSNLETSLRFLVQGADPNYYH---EDKLSTPLHMAAKFGQASQIEMLLIYG 240
            .|..|.:||..:....:|:|::..|..|:......   |....|.||:|.:.|.....::|:.||
Human   583 TELSLGQQLLRATADEDLQTAILLLAHGSCEEVNETCGEGDGCTALHLACRKGNVVLAQLLIWYG 647

  Fly   241 ADVNALDGNGMTPLELARANNHNTIAERLLDAMYDVTDRII 281
            .||.|.|.:|.|.|..||..:.......||  .|...|..:
Human   648 VDVMARDAHGNTALTYARQASSQECINVLL--QYGCPDECV 686

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GitNP_610599.3 ArfGap 48..164 CDD:279720 39/114 (34%)
Ank_2 187..279 CDD:289560 26/94 (28%)
ANK <187..270 CDD:238125 23/85 (27%)
ANK repeat 187..213 CDD:293786 5/25 (20%)
ANK repeat 215..247 CDD:293786 11/31 (35%)
ANK repeat 249..279 CDD:293786 8/29 (28%)
GIT_SHD 314..342 CDD:285690
GIT 374..404 CDD:128828
GIT1_C 609..727 CDD:289013
AGAP6NP_001071133.2 PH_AGAP 280..447 CDD:241281
PH 283..442 CDD:278594
ArfGap 466..580 CDD:279720 40/126 (32%)
Ank_2 591..681 CDD:289560 26/91 (29%)
ANK repeat 591..621 CDD:293786 5/29 (17%)
ANK <594..677 CDD:238125 22/82 (27%)
ANK repeat 623..654 CDD:293786 11/30 (37%)
ANK repeat 656..681 CDD:293786 8/26 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.