powered by:
Protein Alignment Git and ArfGAP1
DIOPT Version :9
Sequence 1: | NP_610599.3 |
Gene: | Git / 36122 |
FlyBaseID: | FBgn0033539 |
Length: | 731 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_524040.2 |
Gene: | ArfGAP1 / 39417 |
FlyBaseID: | FBgn0020655 |
Length: | 468 |
Species: | Drosophila melanogaster |
Alignment Length: | 69 |
Identity: | 25/69 - (36%) |
Similarity: | 38/69 - (55%) |
Gaps: | 2/69 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 27 ATPTISTRSKMPRGKSRLQTEVCGDCGAGDPSWASINRGILLCADCCSVHRSLGRHISIVKSLRQ 91
|:| .||..:...|.:.:...|.:||..:|.|.|:..||.:|.:|...|||||.|:|.|:|:..
Fly 2 ASP--RTRRVLQELKPQDENSKCFECGTHNPQWVSVTYGIWICLECSGKHRSLGVHLSFVRSVTM 64
Fly 92 GNWE 95
..|:
Fly 65 DKWK 68
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C45464119 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5347 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.830 |
|
Return to query results.
Submit another query.