DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Git and CenG1A

DIOPT Version :9

Sequence 1:NP_610599.3 Gene:Git / 36122 FlyBaseID:FBgn0033539 Length:731 Species:Drosophila melanogaster
Sequence 2:NP_723849.1 Gene:CenG1A / 34803 FlyBaseID:FBgn0028509 Length:995 Species:Drosophila melanogaster


Alignment Length:243 Identity:75/243 - (30%)
Similarity:116/243 - (47%) Gaps:39/243 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 ATPT-----ISTRSKMPRGKSRLQTEVCGDCGAGDPSWASINRGILLCADCCSVHRSLGRHISIV 86
            ||.|     ::.|.::| |..     .|.||||.:|.|||:|.|:|:|.:|..|||:||.|||.|
  Fly   696 ATSTDLAAMLAIRQRVP-GNG-----FCVDCGAPNPEWASLNLGVLMCIECSGVHRNLGSHISKV 754

  Fly    87 KSLRQGNWEPSVLNFVNSLNAHGANSVWEHHLLDGSTNSTGGKHVPRWR-KPTPKDALHPTKSDF 150
            :||...:|....|:.:.::....||||||.:              .|.| ||| ..|....|..:
  Fly   755 RSLGLDDWPSPHLSVMLAIGNSLANSVWESN--------------TRQRVKPT-SQASREDKERW 804

  Fly   151 IKAKHVNLTFVLKPSLQDDDDGNGSAGCLEQELSRQLHASVRTSNLETSLRFLV----QGADPNY 211
            :::|:....| |.|.      ||||:........:||..:|..:::::.:..|.    :..:.|.
  Fly   805 VRSKYEAKEF-LTPL------GNGSSAHPSPSPGQQLIEAVIRADIKSIVSILANCPSEVTNANV 862

  Fly   212 YHEDKLSTPLHMAAKFGQASQIEMLLIYGADVNALDGNGMTPLELARA 259
            ...| :.|||.:|...|..:..::|:..||::...|..|.|.|..|||
  Fly   863 SARD-VRTPLLLACAIGNLAIAQLLIWNGANIKHTDHEGRTCLAYARA 909

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GitNP_610599.3 ArfGap 48..164 CDD:279720 43/116 (37%)
Ank_2 187..279 CDD:289560 20/77 (26%)
ANK <187..270 CDD:238125 20/77 (26%)
ANK repeat 187..213 CDD:293786 4/29 (14%)
ANK repeat 215..247 CDD:293786 9/31 (29%)
ANK repeat 249..279 CDD:293786 6/11 (55%)
GIT_SHD 314..342 CDD:285690
GIT 374..404 CDD:128828
GIT1_C 609..727 CDD:289013
CenG1ANP_723849.1 SelP_N <5..41 CDD:282453
Centaurin_gamma 143..300 CDD:133303
RAS 144..295 CDD:214541
PH_AGAP 451..686 CDD:241281
PH 454..>521 CDD:278594
ArfGap 702..818 CDD:279720 46/137 (34%)
ANK <834..907 CDD:238125 17/73 (23%)
ANK repeat 834..866 CDD:293786 4/31 (13%)
Ank_5 859..907 CDD:290568 14/48 (29%)
ANK repeat 868..897 CDD:293786 8/28 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464124
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.