DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Git and Acap3

DIOPT Version :9

Sequence 1:NP_610599.3 Gene:Git / 36122 FlyBaseID:FBgn0033539 Length:731 Species:Drosophila melanogaster
Sequence 2:NP_001382677.1 Gene:Acap3 / 313772 RGDID:1310711 Length:833 Species:Rattus norvegicus


Alignment Length:490 Identity:120/490 - (24%)
Similarity:164/490 - (33%) Gaps:199/490 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SSIIEAHRKLFIAPPDLDHSD-------PATPTI----STRSKMPRGKSRLQ-------TEVCGD 51
            :||..|:|:    .||..:|:       |:|.:|    .:|.:..:|:|.||       ...|||
  Rat   360 ASIASAYRE----SPDSCYSERLDRTASPSTSSIDSTTDSRERGVKGESVLQRVQSVAGNSQCGD 420

  Fly    52 CGAGDPSWASINRGILLCADCCSVHRSLGRHISIVKSLRQGNWEPSVLNFVNSLNAHGANSVWEH 116
            ||..||.|||||.|:|||.:|..:|||||.|.|.|:||...:|||.:|..:..|..:..|.::|.
  Rat   421 CGQPDPRWASINLGVLLCIECSGIHRSLGVHCSKVRSLTLDSWEPELLKLMCELGNNTMNQIYEA 485

  Fly   117 HLLDGSTNSTGGKHVPRWRKPTPKDALHPTKSDFIKAKHVNLTFV-------------------- 161
            . .:|          |..||||...: ...|..:||.|:|...|:                    
  Rat   486 Q-CEG----------PGIRKPTASSS-RQDKEAWIKDKYVEKKFLRKLTSAPVREPPRRWRAQKC 538

  Fly   162 -----------------LKP--------------------------------------------- 164
                             |:|                                             
  Rat   539 QRPHSSPHAPTTRRKVRLEPVLPSVAALSSAGTMERKFRRDSLFCPDELDSLFSYFDAGAAGAGP 603

  Fly   165 -SLQDDDDGNGSA----------------------GCLEQELSRQL------------------- 187
             ||..|....||:                      |...:|.|.::                   
  Rat   604 RSLSSDSGLGGSSDGSSDVLAFGTGSVVDSVTEEEGAESEESSSEVDGEAEAWSLADVRELHPGL 668

  Fly   188 --HASVRTSNLETSLRFLVQGADPNYYH-EDKLSTPLHMAAKFGQASQIEMLLIYGADVNALDGN 249
              |.:.||.:|......|..||:.|:.. .|:..|||..|...|.....|.||..|||||..|..
  Rat   669 LAHQAARTRDLPALAAALAHGAEVNWADTADEGKTPLVQAVLGGSLIVCEFLLQNGADVNQRDSL 733

  Fly   250 GMTPLELARANNHNTIAERLLDAMYDVTDRIITFLGGKKPDHASGRHM-----IIPDANGADISE 309
            |..||      :|.|:..|        |.::..||......||..:..     |...|..|||..
  Rat   734 GRAPL------HHATLLGR--------TGQVCLFLKRGADQHALDQEQQDPLTIAVQAANADIVT 784

  Fly   310 QLKIARGKLQLVPNKMFEELVMDLYDEVDRRECEA 344
            .|::||         |.||:          ||.||
  Rat   785 LLRLAR---------MAEEM----------REAEA 800

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GitNP_610599.3 ArfGap 48..164 CDD:279720 47/152 (31%)
Ank_2 187..279 CDD:289560 30/113 (27%)
ANK <187..270 CDD:238125 29/104 (28%)
ANK repeat 187..213 CDD:293786 8/46 (17%)
ANK repeat 215..247 CDD:293786 14/31 (45%)
ANK repeat 249..279 CDD:293786 7/29 (24%)
GIT_SHD 314..342 CDD:285690 6/27 (22%)
GIT 374..404 CDD:128828
GIT1_C 609..727 CDD:289013
Acap3NP_001382677.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.