DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Git and cnt5

DIOPT Version :9

Sequence 1:NP_610599.3 Gene:Git / 36122 FlyBaseID:FBgn0033539 Length:731 Species:Drosophila melanogaster
Sequence 2:NP_595897.1 Gene:cnt5 / 2539865 PomBaseID:SPBC17G9.08c Length:870 Species:Schizosaccharomyces pombe


Alignment Length:240 Identity:58/240 - (24%)
Similarity:97/240 - (40%) Gaps:54/240 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 IAPPDLDHSDPATPTISTRSKMPRGKSRLQT--------EVCGDCG-AGDPSWASINRGILLCAD 71
            :..|...:||      |...|..:..|.::|        :.|.||. .....|.:||..::||.|
pombe   651 VTSPSRHNSD------SKEKKQTKSPSLVKTLKEMHSSDQSCADCNTTARVEWCAINFPVVLCID 709

  Fly    72 CCSVHRSLGRHISIVKSLRQGNWEPSVLNFVNSLNAHGANSVWEHHLLDGSTNSTGGKHVPRWRK 136
            |..:|||||.||:.::||....:.|..::.:.:......|.::|..:.|             |:.
pombe   710 CSGIHRSLGTHITKIRSLTLDKFNPETVDLLYATGNSFVNEIYEGGITD-------------WKI 761

  Fly   137 PTPKDALHPTKSDFIKAKHVNLTFVLKPSLQDDDDGNGSAGCLEQELSRQLHASVRTSNLETSLR 201
            ...::  ...:..|:|.|::...|: |.|...|.    :.|.||         |:..|||:.::.
pombe   762 KNFEN--QERRVQFVKDKYLYKRFI-KSSFSHDP----NTGLLE---------SIEHSNLKEAVL 810

  Fly   202 FLVQGADPNYYHE--DKLSTPLHMAAKFGQASQIEMLLIYGADVN 244
            .|..|||.||...  ..|....::.|        |:|.:.||.:|
pombe   811 CLALGADVNYQRAVVKALLKNNYLIA--------ELLTLNGASLN 847

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GitNP_610599.3 ArfGap 48..164 CDD:279720 28/116 (24%)
Ank_2 187..279 CDD:289560 17/60 (28%)
ANK <187..270 CDD:238125 17/60 (28%)
ANK repeat 187..213 CDD:293786 10/25 (40%)
ANK repeat 215..247 CDD:293786 7/30 (23%)
ANK repeat 249..279 CDD:293786
GIT_SHD 314..342 CDD:285690
GIT 374..404 CDD:128828
GIT1_C 609..727 CDD:289013
cnt5NP_595897.1 BAR_ArfGAP_fungi 257..455 CDD:153292
PH-like 513..614 CDD:302622
PH 532..614 CDD:278594
COG5347 671..>870 CDD:227651 53/214 (25%)
ArfGap 674..787 CDD:279720 30/128 (23%)
ANK repeat 791..821 CDD:293786 13/42 (31%)
ANK repeat 822..847 CDD:293786 6/32 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.