DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Git and Adap2

DIOPT Version :9

Sequence 1:NP_610599.3 Gene:Git / 36122 FlyBaseID:FBgn0033539 Length:731 Species:Drosophila melanogaster
Sequence 2:NP_742145.1 Gene:Adap2 / 216991 MGIID:2663075 Length:381 Species:Mus musculus


Alignment Length:232 Identity:62/232 - (26%)
Similarity:95/232 - (40%) Gaps:40/232 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 CGDCGAGDPSWASINRGILLCADCCSVHRSLGRHISIVKSLRQGNWEPSVLNFVNSLNAHGANSV 113
            |.||||.||.|||...||.:|..|..|||:. ..||.|||:|...|:.|::.|:.          
Mouse    25 CADCGAADPDWASYKLGIFICLHCSGVHRNF-PDISKVKSVRLDFWDDSMVEFMT---------- 78

  Fly   114 WEHHLLDGSTN--STGGKHVPR-WRKPTPKDALHPTKSDFIKAKHVNLTF------VLKPSLQDD 169
              ||   |:.|  :.....||. :..|...|.| ..|..:|:||:....|      |..|..::.
Mouse    79 --HH---GNLNVKAKFEARVPAFYYVPQANDCL-VLKEQWIRAKYERQEFTAIDKAVSHPGNREG 137

  Fly   170 ---DDGNGSAGCLEQE---LSRQLHASVRTSNLETSLRFLVQGADPN-YYHEDKLSTPLHMAAKF 227
               ..|..:|..|.:.   |||:......|.....:.:.::...|.| .:..:|:..|..:...:
Mouse   138 FLWKRGRDNAQFLRRRFVLLSREGLLKYYTKEEGKAPKAVISIKDLNATFQTEKIGHPHGLQITY 202

  Fly   228 GQASQIEMLLIY---GADV----NALDGNGMTPLELA 257
            .:......|.:|   |.::    |||....:..|:||
Mouse   203 RKEGHTRNLFVYHDSGKEIVDWFNALRAARLQYLKLA 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GitNP_610599.3 ArfGap 48..164 CDD:279720 41/123 (33%)
Ank_2 187..279 CDD:289560 14/79 (18%)
ANK <187..270 CDD:238125 14/79 (18%)
ANK repeat 187..213 CDD:293786 3/26 (12%)
ANK repeat 215..247 CDD:293786 7/38 (18%)
ANK repeat 249..279 CDD:293786 3/9 (33%)
GIT_SHD 314..342 CDD:285690
GIT 374..404 CDD:128828
GIT1_C 609..727 CDD:289013
Adap2NP_742145.1 ArfGap 9..123 CDD:279720 39/114 (34%)
PH1_ADAP 133..241 CDD:270072 20/107 (19%)
PH 135..231 CDD:278594 17/95 (18%)
PH2_ADAP 255..362 CDD:241282
PH 258..361 CDD:278594
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.