powered by:
Protein Alignment Git and K02B12.7
DIOPT Version :9
Sequence 1: | NP_610599.3 |
Gene: | Git / 36122 |
FlyBaseID: | FBgn0033539 |
Length: | 731 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_492310.1 |
Gene: | K02B12.7 / 172643 |
WormBaseID: | WBGene00010500 |
Length: | 423 |
Species: | Caenorhabditis elegans |
Alignment Length: | 47 |
Identity: | 20/47 - (42%) |
Similarity: | 31/47 - (65%) |
Gaps: | 0/47 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 49 CGDCGAGDPSWASINRGILLCADCCSVHRSLGRHISIVKSLRQGNWE 95
|.:|.|.:|.|.|::.||.:|.:|..:|||||.|:|.|:|:....|:
Worm 22 CFECEANNPQWVSVSYGIWICLECSGIHRSLGVHLSFVRSVTMDKWK 68
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5347 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.900 |
|
Return to query results.
Submit another query.