DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11883 and DIG1

DIOPT Version :9

Sequence 1:NP_001097260.1 Gene:CG11883 / 36121 FlyBaseID:FBgn0033538 Length:792 Species:Drosophila melanogaster
Sequence 2:NP_015276.1 Gene:DIG1 / 856058 SGDID:S000005970 Length:452 Species:Saccharomyces cerevisiae


Alignment Length:185 Identity:43/185 - (23%)
Similarity:63/185 - (34%) Gaps:35/185 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 TGSGRSGGAAAMGNVVGWLKQASIEVRDAGTRTLSMLQSSNPNF-RSLDLSLGTPTPTTPTSSEI 108
            ||..|.....:..:.||....|....:.|..|...|:.:...:| |...||..|...:..||:  
Yeast   280 TGKTRRSEEGSRNSSVGSSANAGPTQQRADLRPADMIPAEEYHFERDALLSANTKARSASTST-- 342

  Fly   109 PAAPASATASLSGSTLQFGPEEP----EEGSAAGGSQSLTPLDARELLTRPT-RAYASVSQP--Q 166
                 |.:.|.:.....:...||    |||:.........|        .|| ..:...|||  |
Yeast   343 -----STSTSTNRDRSSWHEAEPNKDEEEGTDLAIEDGAVP--------TPTFTTFQRTSQPQQQ 394

  Fly   167 SPRHRGSGCGSVSGS-RIITHGLTGRSTSISSQLEKTKKLLKMTE---GEDKPLT 217
            ||       ..:.|. |:.:|.........||.::| |..:.:..   .|.|.||
Yeast   395 SP-------SLLQGEIRLSSHIFAFEFPLSSSNVDK-KMFMSICNKVWNESKELT 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11883NP_001097260.1 UshA 202..661 CDD:223808 5/19 (26%)
MPP_CG11883_N 216..473 CDD:277351 2/2 (100%)
5_nucleotid_C 494..646 CDD:280945
DIG1NP_015276.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S12546
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.