DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11883 and GOLM1

DIOPT Version :9

Sequence 1:NP_001097260.1 Gene:CG11883 / 36121 FlyBaseID:FBgn0033538 Length:792 Species:Drosophila melanogaster
Sequence 2:NP_057632.2 Gene:GOLM1 / 51280 HGNCID:15451 Length:401 Species:Homo sapiens


Alignment Length:292 Identity:58/292 - (19%)
Similarity:94/292 - (32%) Gaps:85/292 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   500 VELDGRFSRVRTQETNLGNWVCDVVLAAVGADVVILNGGTFRS---------DRVHPVGAFTMGD 555
            :||:||..|                 ||.....|.|....|:.         |::.....|.: :
Human    47 MELEGRVRR-----------------AAAERGAVELKKNEFQGELEKQREQLDKIQSSHNFQL-E 93

  Fly   556 LVNVIPMRDPLILLE--VKGKILWQALENGVSAYPKLEGRFPQVSGISFAFDPQAEPGKRIDPQL 618
            .||.:...:..:|:.  ..|:.|.:.|::.:....:..||..|                    .:
Human    94 SVNKLYQDEKAVLVNNITTGERLIRVLQDQLKTLQRNYGRLQQ--------------------DV 138

  Fly   619 IQVGDEYLNLEQSYKLCVKSYIFMGCDGYTMFKDATVLMDDDACPEL--GITLQNHFKAINSRKC 681
            :|......|||:.:     ||....|  ....|:.     .:.|.|.  .:|.:.: :|:.||..
Human   139 LQFQKNQTNLERKF-----SYDLSQC--INQMKEV-----KEQCEERIEEVTKKGN-EAVASRDL 190

  Fly   682 GQNTKHRQSLVTLSRRHSLVQCLDSMDLDGPSPIRKLSVGHHNKSMDLTHGNSQKMLRRAS---- 742
            .:|...||.|..||.....:|.       ...|..::..|..|     ..|||:......|    
Human   191 SENNDQRQQLQALSEPQPRLQA-------AGLPHTEVPQGKGN-----VLGNSKSQTPAPSSEVV 243

  Fly   743 LDDLEQSTCDLAPQLEHRIVMIQNEEHHRQLL 774
            ||...|     ..:.|...:.:.|||..|..|
Human   244 LDSKRQ-----VEKEETNEIQVVNEEPQRDRL 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11883NP_001097260.1 UshA 202..661 CDD:223808 29/171 (17%)
MPP_CG11883_N 216..473 CDD:277351
5_nucleotid_C 494..646 CDD:280945 28/156 (18%)
GOLM1NP_057632.2 SMC_prok_A <41..>211 CDD:274009 41/214 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 178..401 27/111 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S12546
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.