DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment psq and KBTBD2

DIOPT Version :10

Sequence 1:NP_001369078.1 Gene:psq / 36118 FlyBaseID:FBgn0263102 Length:1170 Species:Drosophila melanogaster
Sequence 2:NP_056298.2 Gene:KBTBD2 / 25948 HGNCID:21751 Length:623 Species:Homo sapiens


Alignment Length:139 Identity:35/139 - (25%)
Similarity:66/139 - (47%) Gaps:18/139 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 SVFQQLR---EDLSFVDVTLSCEHGSLKAHKVVLSACSTYFQKLLLE--NPCKHPTIILPADIIF 82
            |:.:||:   |...|.|:.|..|......||:||:.||:||:.:.:.  :..|...:.| .::..
Human    16 SLLEQLKLFYEQQLFTDIVLIVEGTEFPCHKMVLATCSSYFRAMFMSGLSESKQTHVHL-RNVDA 79

  Fly    83 TDLKTIIDFVYRGEIDVTESELQGLLRTAEQLKIKGLCE----------TAENADDLNDAATATI 137
            ..|:.||.:.|.|.:.:.:|.::.|..||..|:::.:.:          .|||...|  .:.|.:
Human    80 ATLQIIITYAYTGNLAMNDSTVEQLYETACFLQVEDVLQRCREYLIKKINAENCVRL--LSFADL 142

  Fly   138 TVSENIQQA 146
            ...|.::|:
Human   143 FSCEELKQS 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
psqNP_001369078.1 BTB_POZ_BAB-like 34..118 CDD:349624 24/85 (28%)
HTH_psq 717..>747 CDD:283007
HTH_psq 767..804 CDD:283007
HTH_psq 821..866 CDD:283007
HTH_psq 873..916 CDD:283007
KBTBD2NP_056298.2 BTB_POZ_KBTBD2_BKLHD1 5..137 CDD:349579 32/123 (26%)
PHA03098 23..516 CDD:222983 32/132 (24%)
BACK_KBTBD2 128..223 CDD:350554 7/26 (27%)
KELCH repeat 310..366 CDD:276965
Kelch 1. /evidence=ECO:0000255 317..380
KELCH repeat 370..416 CDD:276965
Kelch 2. /evidence=ECO:0000255 381..429
KELCH repeat 419..453 CDD:276965
Kelch 3. /evidence=ECO:0000255 431..469
KELCH repeat 459..516 CDD:276965
Kelch 4. /evidence=ECO:0000255 470..529
KELCH repeat 519..568 CDD:276965
Kelch 5. /evidence=ECO:0000255 535..581
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.