DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment psq and LOC1276686

DIOPT Version :10

Sequence 1:NP_001369078.1 Gene:psq / 36118 FlyBaseID:FBgn0263102 Length:1170 Species:Drosophila melanogaster
Sequence 2:XP_061504152.1 Gene:LOC1276686 / 1276686 VectorBaseID:AGAMI1_011036 Length:1131 Species:Anopheles gambiae


Alignment Length:146 Identity:34/146 - (23%)
Similarity:52/146 - (35%) Gaps:48/146 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 KKLLEHKEVESRLKEVR-------------ETLKELTKQFDKSENDLKALQSVGQIVGEVLKQLT 68
            |:|||.|| |..:||:|             |....|.........|||||..:...|..|.....
Mosquito    24 KQLLERKE-ELGIKEIRSLDIVPYKNNIGHEETSLLRTYVADIGGDLKALSPIFNGVDGVFHCAA 87

  Fly    69 EDKFIVKATNGPRYVVGCRRQLDKTKLKSGTRVALDM-----------TTLTIMRYLPREVDPLV 122
            .    ||....|.|     .:|::..: :||...:|:           |:.|.:.::|.:     
Mosquito    88 S----VKIEYPPNY-----EELERVNV-NGTLAVVDLCIQNNVKRLVYTSCTSVCFVPFK----- 137

  Fly   123 YNMSHEDPGEVTYSAI 138
                    |..|:||:
Mosquito   138 --------GRSTFSAV 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
psqNP_001369078.1 BTB_POZ_BAB-like 34..118 CDD:349624 20/94 (21%)
HTH_psq 717..>747 CDD:283007
HTH_psq 767..804 CDD:283007
HTH_psq 821..866 CDD:283007
HTH_psq 873..916 CDD:283007
LOC1276686XP_061504152.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.