DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment psq and Btbd18

DIOPT Version :9

Sequence 1:NP_001369078.1 Gene:psq / 36118 FlyBaseID:FBgn0263102 Length:1170 Species:Drosophila melanogaster
Sequence 2:XP_002729248.1 Gene:Btbd18 / 100363270 RGDID:2323370 Length:724 Species:Rattus norvegicus


Alignment Length:337 Identity:86/337 - (25%)
Similarity:131/337 - (38%) Gaps:64/337 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 YQNT--MTSVFQQLREDLS---FVDVTLSCEHGSLKAHKVVLSACSTYF-QKLLLENPCKHPTII 75
            |:|.  :...|.||.....   |.|..|..|..::.||..:|||||.:| ::|..|.|.:...::
  Rat    11 YRNPRFLRVAFLQLHHQQQSGVFCDALLQAEGEAVPAHCCILSACSPFFTERLERERPVQGRKVV 75

  Fly    76 LP-ADIIFTDLKTIIDFVYRGEIDVTESELQGLLRTAEQLKIKGLCETAE-NADDLNDAATATIT 138
            |. ..:....|:.::||:|..|::|::.|.|.:|..|.||::..| ||.: ....|..|......
  Rat    76 LELGGLKIQTLRKLVDFLYTSEMEVSQEEAQDVLSAARQLRVSEL-ETLQLEGGKLVKAPQGRRL 139

  Fly   139 VSENIQQAVVGNIVNAAIVPGA-----------PSP-------SLEQQQQHHQQQQQQQAQEQHQ 185
            ..|.:|......|....:||.:           |||       ||.:::..|::.....|.....
  Rat   140 NRECLQPPSAAPISARVVVPRSRPRTPLPVTQTPSPLGAVKLKSLGEEEGAHKKSNLPNADNLSD 204

  Fly   186 QQQVHAQQQQQQQQQINAALLTQHGVSSGSVSLSGQLLSSSASGSSGSLAGGQQASQTPSGLQPT 250
            ...:..:.:         ..|||...||.|....|...:.|..||:.          .|| |.|:
  Rat   205 TLLLKKKAR---------VCLTQERSSSPSSQREGPKENKSNPGSTA----------LPS-LYPS 249

  Fly   251 ------PRKSRLKRSK-SPDLSSGGGAGSSGGSSSGSTQQQPQPAHHHHPQTIL------IQGQN 302
                  |||.||.||| ||.:.:...:....|.||..|    .|......|..:      :..|.
  Rat   250 VDEQLLPRKIRLSRSKPSPHVYTSKPSSMLSGPSSMPT----APGRRLWRQRTVSEATQGVDKQK 310

  Fly   303 PNSIVSLQQTAD 314
            |..:.:||.|.|
  Rat   311 PGEVSTLQSTPD 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
psqNP_001369078.1 BTB_POZ_BAB-like 34..118 CDD:349624 28/85 (33%)
HTH_psq 717..>747 CDD:283007
HTH_psq 767..804 CDD:283007
HTH_psq 821..866 CDD:283007
HTH_psq 873..916 CDD:283007
Btbd18XP_002729248.1 BTB 24..123 CDD:279045 31/99 (31%)
BTB 35..123 CDD:197585 29/88 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000141
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.