Sequence 1: | NP_610592.1 | Gene: | CG17765 / 36111 | FlyBaseID: | FBgn0033529 | Length: | 199 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_011572.2 | Gene: | PEF1 / 852949 | SGDID: | S000003290 | Length: | 335 | Species: | Saccharomyces cerevisiae |
Alignment Length: | 242 | Identity: | 63/242 - (26%) |
---|---|---|---|
Similarity: | 93/242 - (38%) | Gaps: | 58/242 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 7 YNPYAQPGGGYAPPP---------------GAFPP---QNAQVSPQ------------------- 34
Fly 35 --AQQWFSMVDRDRSGKINASELQAALVNGRGDHFSDNACKLMISMFDNDASGTIDIYEFEKLYN 97
Fly 98 YINQWLQVFKTYDQDSSGHIEEQELTQAFTQMGFRFS-----------PEFINFLVKKSDPQGHK 151
Fly 152 EVSVDQFIVLCVQVQRFTEAFRQRDTQQNGTITIGFEDFL--TVAIG 196 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG17765 | NP_610592.1 | FRQ1 | 26..162 | CDD:227455 | 40/170 (24%) |
EFh | 39..92 | CDD:238008 | 14/52 (27%) | ||
EFh | 105..159 | CDD:298682 | 14/64 (22%) | ||
PEF1 | NP_011572.2 | EFh_PEF_Group_I | 161..329 | CDD:320055 | 50/173 (29%) |
EF-hand motif | 161..190 | CDD:320055 | 10/28 (36%) | ||
EF-hand motif | 198..227 | CDD:320055 | 8/28 (29%) | ||
EF-hand motif | 228..257 | CDD:320055 | 6/28 (21%) | ||
EF-hand motif | 264..298 | CDD:320055 | 10/39 (26%) | ||
EF-hand motif | 300..328 | CDD:320055 | 12/27 (44%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0037 | |
Hieranoid | 1 | 1.000 | - | - | ||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 80 | 1.000 | Inparanoid score | I1621 |
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000697 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 1 | 0.900 | - | - | OOG6_100410 | |
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R2225 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 1 | 0.960 | - | - | ||
8 | 7.750 |