DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17765 and PEF1

DIOPT Version :9

Sequence 1:NP_610592.1 Gene:CG17765 / 36111 FlyBaseID:FBgn0033529 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_011572.2 Gene:PEF1 / 852949 SGDID:S000003290 Length:335 Species:Saccharomyces cerevisiae


Alignment Length:242 Identity:63/242 - (26%)
Similarity:93/242 - (38%) Gaps:58/242 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YNPYAQPGGGYAPPP---------------GAFPP---QNAQVSPQ------------------- 34
            ||..||...|...||               .:.||   .|..|..|                   
Yeast    95 YNVIAQKPAGRPIPPAPTHYNNLNTSAQRIASSPPPLIHNQAVPAQLLKKVAPASFDSREDVRDM 159

  Fly    35 --AQQWFSMVDRDRSGKINASELQAALVNGRGDHFSDNACKLMISMFDNDASGTIDIYEFEKLYN 97
              |.|.|...|.....::.|.|||..|.|....||..::...:|::|.....||::..||..||.
Yeast   160 QVATQLFHNHDVKGKNRLTAEELQNLLQNDDNSHFCISSVDALINLFGASRFGTVNQAEFIALYK 224

  Fly    98 YINQWLQVFKTYDQDSSGHIEEQELTQAFTQMGFRFS-----------PEFINFLVKKSDPQGHK 151
            .:..|.:|:...|.:.|..|...|...:..::|:...           .||||     .:..| |
Yeast   225 RVKSWRKVYVDNDINGSLTISVSEFHNSLQELGYLIPFEVSEKTFDQYAEFIN-----RNGTG-K 283

  Fly   152 EVSVDQFIVLCVQVQRFTEAFRQRDTQQNGTITIGFEDFL--TVAIG 196
            |:..|:|:...|.:.|.|:.||:.||.|.|..||.::||:  |:.:|
Yeast   284 ELKFDKFVEALVWLMRLTKLFRKFDTNQEGIATIQYKDFIDATLYLG 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17765NP_610592.1 FRQ1 26..162 CDD:227455 40/170 (24%)
EFh 39..92 CDD:238008 14/52 (27%)
EFh 105..159 CDD:298682 14/64 (22%)
PEF1NP_011572.2 EFh_PEF_Group_I 161..329 CDD:320055 50/173 (29%)
EF-hand motif 161..190 CDD:320055 10/28 (36%)
EF-hand motif 198..227 CDD:320055 8/28 (29%)
EF-hand motif 228..257 CDD:320055 6/28 (21%)
EF-hand motif 264..298 CDD:320055 10/39 (26%)
EF-hand motif 300..328 CDD:320055 12/27 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0037
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 80 1.000 Inparanoid score I1621
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000697
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100410
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2225
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.750

Return to query results.
Submit another query.