DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17765 and CAPN2

DIOPT Version :9

Sequence 1:NP_610592.1 Gene:CG17765 / 36111 FlyBaseID:FBgn0033529 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001739.3 Gene:CAPN2 / 824 HGNCID:1479 Length:700 Species:Homo sapiens


Alignment Length:229 Identity:52/229 - (22%)
Similarity:95/229 - (41%) Gaps:43/229 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 NPYAQPGGGYAPPPGAFPPQN-----AQVSPQAQQWFSMVDRD---------------------- 45
            |.:..|.|.|...|..|.|..     .:|..:.:..:..||.:                      
Human   473 NRFKLPPGEYILVPSTFEPNKDGDFCIRVFSEKKADYQAVDDEIEANLEEFDISEDDIDDGFRRL 537

  Fly    46 ------RSGKINASELQAAL-------VNGRGDHFSDNACKLMISMFDNDASGTIDIYEFEKLYN 97
                  ...:|:|.|||..|       .:.:.|.||...||:|:.|.|:|.||.:.:.||..|:.
Human   538 FAQLAGEDAEISAFELQTILRRVLAKRQDIKSDGFSIETCKIMVDMLDSDGSGKLGLKEFYILWT 602

  Fly    98 YINQWLQVFKTYDQDSSGHIEEQELTQAFTQMGFRFSPEFINFLVKK-SDPQGHKEVSVDQFIVL 161
            .|.::.::::..|.|.||.:...|:.:|..:.||:...:....:|.: :|.|  ..:..|.|:..
Human   603 KIQKYQKIYREIDVDRSGTMNSYEMRKALEEAGFKMPCQLHQVIVARFADDQ--LIIDFDNFVRC 665

  Fly   162 CVQVQRFTEAFRQRDTQQNGTITIGFEDFLTVAI 195
            .|:::...:.|:|.|.:..|||.:....:|..::
Human   666 LVRLETLFKIFKQLDPENTGTIELDLISWLCFSV 699

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17765NP_610592.1 FRQ1 26..162 CDD:227455 38/176 (22%)
EFh 39..92 CDD:238008 19/87 (22%)
EFh 105..159 CDD:298682 12/54 (22%)
CAPN2NP_001739.3 Peptidase_C2 46..342 CDD:306994
Domain III 345..514 9/40 (23%)
Calpain_III 363..507 CDD:307285 8/33 (24%)
Linker 515..529 0/13 (0%)
Domain IV 530..700 42/172 (24%)
EFh_PEF_CAPN2 533..700 CDD:320074 42/169 (25%)
EF-hand motif 533..561 CDD:320074 6/27 (22%)
EF-hand motif 576..605 CDD:320074 11/28 (39%)
EF-hand motif 606..636 CDD:320074 6/29 (21%)
EF-hand motif 642..670 CDD:320074 6/29 (21%)
EF-hand motif 672..700 CDD:320074 7/28 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.