Sequence 1: | NP_610592.1 | Gene: | CG17765 / 36111 | FlyBaseID: | FBgn0033529 | Length: | 199 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001739.3 | Gene: | CAPN2 / 824 | HGNCID: | 1479 | Length: | 700 | Species: | Homo sapiens |
Alignment Length: | 229 | Identity: | 52/229 - (22%) |
---|---|---|---|
Similarity: | 95/229 - (41%) | Gaps: | 43/229 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 8 NPYAQPGGGYAPPPGAFPPQN-----AQVSPQAQQWFSMVDRD---------------------- 45
Fly 46 ------RSGKINASELQAAL-------VNGRGDHFSDNACKLMISMFDNDASGTIDIYEFEKLYN 97
Fly 98 YINQWLQVFKTYDQDSSGHIEEQELTQAFTQMGFRFSPEFINFLVKK-SDPQGHKEVSVDQFIVL 161
Fly 162 CVQVQRFTEAFRQRDTQQNGTITIGFEDFLTVAI 195 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG17765 | NP_610592.1 | FRQ1 | 26..162 | CDD:227455 | 38/176 (22%) |
EFh | 39..92 | CDD:238008 | 19/87 (22%) | ||
EFh | 105..159 | CDD:298682 | 12/54 (22%) | ||
CAPN2 | NP_001739.3 | Peptidase_C2 | 46..342 | CDD:306994 | |
Domain III | 345..514 | 9/40 (23%) | |||
Calpain_III | 363..507 | CDD:307285 | 8/33 (24%) | ||
Linker | 515..529 | 0/13 (0%) | |||
Domain IV | 530..700 | 42/172 (24%) | |||
EFh_PEF_CAPN2 | 533..700 | CDD:320074 | 42/169 (25%) | ||
EF-hand motif | 533..561 | CDD:320074 | 6/27 (22%) | ||
EF-hand motif | 576..605 | CDD:320074 | 11/28 (39%) | ||
EF-hand motif | 606..636 | CDD:320074 | 6/29 (21%) | ||
EF-hand motif | 642..670 | CDD:320074 | 6/29 (21%) | ||
EF-hand motif | 672..700 | CDD:320074 | 7/28 (25%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |