| Sequence 1: | NP_610592.1 | Gene: | CG17765 / 36111 | FlyBaseID: | FBgn0033529 | Length: | 199 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001185797.1 | Gene: | CAPN1 / 823 | HGNCID: | 1476 | Length: | 714 | Species: | Homo sapiens |
| Alignment Length: | 225 | Identity: | 50/225 - (22%) |
|---|---|---|---|
| Similarity: | 90/225 - (40%) | Gaps: | 44/225 - (19%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 13 PGGGYAPPPGAFPPQ----------------NAQVSPQAQ---------------QWFSMVDRDR 46
Fly 47 SG---KINASELQAALVNGRGDH-------FSDNACKLMISMFDNDASGTIDIYEFEKLYNYINQ 101
Fly 102 WLQVFKTYDQDSSGHIEEQELTQAFTQMGFRFSPEFINFLVKK-SDPQGHKEVSVDQFIVLCVQV 165
Fly 166 QRFTEAFRQRDTQQNGTITIGFEDFLTVAI 195 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG17765 | NP_610592.1 | FRQ1 | 26..162 | CDD:227455 | 38/177 (21%) |
| EFh | 39..92 | CDD:238008 | 15/62 (24%) | ||
| EFh | 105..159 | CDD:298682 | 13/54 (24%) | ||
| CAPN1 | NP_001185797.1 | Peptidase_C2 | 56..352 | CDD:306994 | |
| Domain III | 355..526 | 6/35 (17%) | |||
| Calpain_III | 364..524 | CDD:238132 | 6/33 (18%) | ||
| Linker | 527..542 | 2/14 (14%) | |||
| Domain IV | 543..713 | 42/172 (24%) | |||
| EFh_PEF_CAPN1 | 546..714 | CDD:320073 | 42/169 (25%) | ||
| EF-hand motif | 546..574 | CDD:320073 | 7/27 (26%) | ||
| EF-hand motif | 589..618 | CDD:320073 | 9/28 (32%) | ||
| EF-hand motif | 619..649 | CDD:320073 | 8/29 (28%) | ||
| EF-hand motif | 655..683 | CDD:320073 | 6/29 (21%) | ||
| EF-hand motif | 685..714 | CDD:320073 | 6/28 (21%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||