DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17765 and AT3G10300

DIOPT Version :9

Sequence 1:NP_610592.1 Gene:CG17765 / 36111 FlyBaseID:FBgn0033529 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001327262.1 Gene:AT3G10300 / 820192 AraportID:AT3G10300 Length:377 Species:Arabidopsis thaliana


Alignment Length:183 Identity:62/183 - (33%)
Similarity:83/183 - (45%) Gaps:23/183 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 YGQGYNPYAQP---GGGY-APP-------------PGAFPPQNAQVSPQAQQWFSMVDRDRSGKI 50
            :|.||....|.   |||| |||             |.||||   ...|.....|...|||.||.|
plant   123 HGGGYGGAPQQSGHGGGYGAPPPQASYGSPFASLVPSAFPP---GTDPNIVACFQAADRDNSGFI 184

  Fly    51 NASELQAALVNGRGDHFSDNACKLMISMFDNDASGTIDIYEFEKLYNYINQWLQVFKTYDQDSSG 115
            :..|||.|| :.....||.....|::.:|.|.....|...||..|:..:..|..:|:.:|:|.||
plant   185 DDKELQGAL-SSYNQSFSIRTVHLLMYLFTNSNVRKIGPKEFTSLFFSLQNWRSIFERFDKDRSG 248

  Fly   116 HIEEQELTQAFTQMGFRFSPEFINFLVKKSDPQG--HKEVSVDQFIVLCVQVQ 166
            .|:..||..|...:||..||..::.||.|.|..|  ::.:..|.||..|:.|:
plant   249 RIDTNELRDALMSLGFSVSPVILDLLVSKFDKSGGRNRAIEYDNFIECCLTVK 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17765NP_610592.1 FRQ1 26..162 CDD:227455 45/137 (33%)
EFh 39..92 CDD:238008 18/52 (35%)
EFh 105..159 CDD:298682 19/55 (35%)
AT3G10300NP_001327262.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 52 1.000 Domainoid score I4290
eggNOG 1 0.900 - - E1_KOG0037
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H56569
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54126
OrthoDB 1 1.010 - - D1330600at2759
OrthoFinder 1 1.000 - - FOG0000697
OrthoInspector 1 1.000 - - mtm1073
orthoMCL 1 0.900 - - OOG6_100410
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1327
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.690

Return to query results.
Submit another query.