DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17765 and capn12

DIOPT Version :9

Sequence 1:NP_610592.1 Gene:CG17765 / 36111 FlyBaseID:FBgn0033529 Length:199 Species:Drosophila melanogaster
Sequence 2:XP_005173727.1 Gene:capn12 / 799247 ZFINID:ZDB-GENE-050419-245 Length:717 Species:Danio rerio


Alignment Length:152 Identity:32/152 - (21%)
Similarity:63/152 - (41%) Gaps:12/152 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 QAQQWFSMVDRDRSG---KINASELQAALVNG---RGDHFSDNACKLMISMFDNDASGTIDIYEF 92
            :.|:||    .:::|   ::||.:.. .|||.   :........|:.:|...|....|.:|..:.
Zfish   556 RVQKWF----EEKAGSDERVNAVQFM-NLVNSVLEKDYELPLETCRQLIFGEDTGGRGRLDRAQA 615

  Fly    93 EKLYNYINQWLQVFKTYDQDSSGHIEEQELTQAFTQMGFRFSPEFINFLVKKSDPQGHKEVSVDQ 157
            |||.:.:.....:|..:|:||||.:...||:.|....|.......:..|.::.. .|.:.:....
Zfish   616 EKLLSSLRNLQSIFFQFDEDSSGTMSPFELSLALNAAGVECDSVVVQMLWERFG-AGEQYLPFYG 679

  Fly   158 FIVLCVQVQRFTEAFRQRDTQQ 179
            |:....::|...:.:.....|:
Zfish   680 FVSCVARLQVLFDLYEAETNQE 701

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17765NP_610592.1 FRQ1 26..162 CDD:227455 30/133 (23%)
EFh 39..92 CDD:238008 12/58 (21%)
EFh 105..159 CDD:298682 12/53 (23%)
capn12XP_005173727.1 Peptidase_C2 32..327 CDD:279042
Calpain_III 346..527 CDD:279416
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.