DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17765 and Sri

DIOPT Version :9

Sequence 1:NP_610592.1 Gene:CG17765 / 36111 FlyBaseID:FBgn0033529 Length:199 Species:Drosophila melanogaster
Sequence 2:XP_038964278.1 Gene:Sri / 683667 RGDID:1584485 Length:211 Species:Rattus norvegicus


Alignment Length:180 Identity:63/180 - (35%)
Similarity:101/180 - (56%) Gaps:10/180 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 GYAPPPGAFPPQNAQVSPQAQQWFSMVDRDRSGKINASELQAAL----VNGRGDHFSDNACKLMI 76
            |.||....||   .........:|:.| ..:.|:|:|.|||..|    :.|....|:...|:||:
  Rat    32 GGAPGGPVFP---GHTQDPLYGYFAAV-AGQDGQIDADELQRCLTQSGIAGGYKPFNLETCRLMV 92

  Fly    77 SMFDNDASGTIDIYEFEKLYNYINQWLQVFKTYDQDSSGHIEEQELTQAFTQMGFRFSPEFINFL 141
            ||.|.|.|||:...||.:|:..::.|.|.|.::|.|.||.::.|||.:|.|.||||.||:.:|.:
  Rat    93 SMLDRDMSGTMGFSEFRELWTVLSGWRQHFISFDSDRSGTVDPQELQKALTTMGFRLSPQTVNSV 157

  Fly   142 VKKSDPQGHKEVSVDQFIVLCVQVQRFTEAFRQRDTQQNGTITIGFEDFL 191
            .|:....|  :::.|.:|..||:::..|::||:||:.|.|.:...::||:
  Rat   158 AKRYSTSG--KITFDDYIACCVKLRALTDSFRRRDSGQQGVVNFSYDDFI 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17765NP_610592.1 FRQ1 26..162 CDD:227455 47/139 (34%)
EFh 39..92 CDD:238008 21/56 (38%)
EFh 105..159 CDD:298682 20/53 (38%)
SriXP_038964278.1 EFh_PEF_sorcin 47..211 CDD:320062 58/162 (36%)
EF-hand motif 47..75 CDD:320062 9/28 (32%)
EF-hand motif 87..116 CDD:320062 13/28 (46%)
EF-hand motif 117..146 CDD:320062 12/28 (43%)
EF-hand motif 153..180 CDD:320062 7/28 (25%)
EF-hand motif 182..210 CDD:320062 9/24 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0037
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54126
OrthoDB 1 1.010 - - D1330600at2759
OrthoFinder 1 1.000 - - FOG0000697
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100410
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.730

Return to query results.
Submit another query.