DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17765 and Capns2

DIOPT Version :9

Sequence 1:NP_610592.1 Gene:CG17765 / 36111 FlyBaseID:FBgn0033529 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001102850.1 Gene:Capns2 / 679870 RGDID:1583620 Length:247 Species:Rattus norvegicus


Alignment Length:204 Identity:48/204 - (23%)
Similarity:88/204 - (43%) Gaps:38/204 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 YAPPPGAFPPQNAQVSPQAQQWFSMVDRDRSGKINASELQAALVNG------------------- 62
            |.|.|           |..|:.|::|:...|.::.....|...:.|                   
  Rat    55 YTPEP-----------PPPQRHFTVVEASESDEVRRFRQQFTQLAGPDMEVGAADLMNILNKVLS 108

  Fly    63 -----RGDHFSDNACKLMISMFDNDASGTIDIYEFEKLYNYINQWLQVFKTYDQDSSGHIEEQEL 122
                 :.|.||.:.|:.::|:.|:|.:|.:...||:.|:|.|.:|..|||.||.|.||.:...:|
  Rat   109 KHKELKTDGFSLDTCRSIVSVMDSDTTGKLGFEEFKYLWNNIKKWQCVFKQYDSDHSGFLRSSQL 173

  Fly   123 TQAFTQMGFRFSPEFINFLVKK-SDPQGHKEVSVDQFIVLCVQVQRFTEAFRQRDTQQNGTITIG 186
            ..|....||:.:.:....:|:: :|..|  .:..:.||...|::.....||:..|..::|.|.:.
  Rat   174 HGAMQAAGFQLNEQLYLMIVRRYADEDG--SMDFNNFISCLVRLDAMFRAFKTLDRDRDGLIRVS 236

  Fly   187 FEDFLTVAI 195
            ..::|.:.:
  Rat   237 IREWLQLTM 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17765NP_610592.1 FRQ1 26..162 CDD:227455 38/160 (24%)
EFh 39..92 CDD:238008 13/76 (17%)
EFh 105..159 CDD:298682 15/54 (28%)
Capns2NP_001102850.1 EFh 123..168 CDD:298682 19/44 (43%)
EF-hand_7 154..209 CDD:290234 15/56 (27%)
EFh 154..209 CDD:298682 15/56 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1330600at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.