Sequence 1: | NP_610592.1 | Gene: | CG17765 / 36111 | FlyBaseID: | FBgn0033529 | Length: | 199 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001102850.1 | Gene: | Capns2 / 679870 | RGDID: | 1583620 | Length: | 247 | Species: | Rattus norvegicus |
Alignment Length: | 204 | Identity: | 48/204 - (23%) |
---|---|---|---|
Similarity: | 88/204 - (43%) | Gaps: | 38/204 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 17 YAPPPGAFPPQNAQVSPQAQQWFSMVDRDRSGKINASELQAALVNG------------------- 62
Fly 63 -----RGDHFSDNACKLMISMFDNDASGTIDIYEFEKLYNYINQWLQVFKTYDQDSSGHIEEQEL 122
Fly 123 TQAFTQMGFRFSPEFINFLVKK-SDPQGHKEVSVDQFIVLCVQVQRFTEAFRQRDTQQNGTITIG 186
Fly 187 FEDFLTVAI 195 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG17765 | NP_610592.1 | FRQ1 | 26..162 | CDD:227455 | 38/160 (24%) |
EFh | 39..92 | CDD:238008 | 13/76 (17%) | ||
EFh | 105..159 | CDD:298682 | 15/54 (28%) | ||
Capns2 | NP_001102850.1 | EFh | 123..168 | CDD:298682 | 19/44 (43%) |
EF-hand_7 | 154..209 | CDD:290234 | 15/56 (27%) | ||
EFh | 154..209 | CDD:298682 | 15/56 (27%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1330600at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |