DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pef and Pef1

DIOPT Version :10

Sequence 1:NP_610592.1 Gene:Pef / 36111 FlyBaseID:FBgn0033529 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_080717.2 Gene:Pef1 / 67898 MGIID:1915148 Length:275 Species:Mus musculus


Alignment Length:193 Identity:83/193 - (43%)
Similarity:111/193 - (57%) Gaps:11/193 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 PYAQ--PGGGYAPPPGAF-----PPQNAQVSPQAQQWFSMVDRDRSGKINASELQAALVNGRGDH 66
            ||.|  |||.|...||.:     ||   .|.|:|..||..||.|.||.|:..||:.||||.....
Mouse    80 PYGQLPPGGPYGTQPGHYGQGGVPP---NVDPEAYSWFQSVDADHSGYISLKELKQALVNSNWSS 141

  Fly    67 FSDNACKLMISMFDNDASGTIDIYEFEKLYNYINQWLQVFKTYDQDSSGHIEEQELTQAFTQMGF 131
            |:|..|.:||:|||...||.||:..|..|:.::.||..:|:.||:|.||.|...||.||.:|||:
Mouse   142 FNDETCLMMINMFDKTKSGRIDVAGFSALWKFLQQWRNLFQQYDRDRSGSISSTELQQALSQMGY 206

  Fly   132 RFSPEFINFLVKKSDPQGH-KEVSVDQFIVLCVQVQRFTEAFRQRDTQQNGTITIGFEDFLTV 193
            ..||:|...||.:...:.. ..:.:|.||.:|.|:|..|||||::||...|.|.:.||||:|:
Mouse   207 NLSPQFTQLLVSRYCARSAIPAMQLDCFIKVCTQLQVLTEAFREKDTAVQGNIRLSFEDFVTM 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PefNP_610592.1 EFh_PEF_peflin 34..198 CDD:320059 70/161 (43%)
EF-hand motif 34..63 CDD:320059 15/28 (54%)
EF-hand motif 71..100 CDD:320059 12/28 (43%)
EF-hand motif 101..131 CDD:320059 15/29 (52%)
EF-hand motif 137..166 CDD:320059 8/29 (28%)
EF-hand motif 167..198 CDD:320059 14/27 (52%)
Pef1NP_080717.2 8 X 9 AA approximate tandem repeat of [AP]-P-G-G-P-Y-G-G-P-P 21..100 9/19 (47%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 21..45
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 59..103 9/22 (41%)
EFh_PEF_peflin 109..274 CDD:320059 70/161 (43%)
EF-hand motif 109..138 CDD:320059 15/28 (54%)
EF-hand motif 146..175 CDD:320059 12/28 (43%)
EF-hand motif 176..206 CDD:320059 15/29 (52%)
Required for interaction with PDCD6. /evidence=ECO:0000250|UniProtKB:Q9UBV8 195..275 32/75 (43%)
EF-hand motif 212..242 CDD:320059 8/29 (28%)
EF-hand motif 243..274 CDD:320059 14/27 (52%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.