DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17765 and Pef1

DIOPT Version :9

Sequence 1:NP_610592.1 Gene:CG17765 / 36111 FlyBaseID:FBgn0033529 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_080717.2 Gene:Pef1 / 67898 MGIID:1915148 Length:275 Species:Mus musculus


Alignment Length:193 Identity:83/193 - (43%)
Similarity:111/193 - (57%) Gaps:11/193 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 PYAQ--PGGGYAPPPGAF-----PPQNAQVSPQAQQWFSMVDRDRSGKINASELQAALVNGRGDH 66
            ||.|  |||.|...||.:     ||   .|.|:|..||..||.|.||.|:..||:.||||.....
Mouse    80 PYGQLPPGGPYGTQPGHYGQGGVPP---NVDPEAYSWFQSVDADHSGYISLKELKQALVNSNWSS 141

  Fly    67 FSDNACKLMISMFDNDASGTIDIYEFEKLYNYINQWLQVFKTYDQDSSGHIEEQELTQAFTQMGF 131
            |:|..|.:||:|||...||.||:..|..|:.::.||..:|:.||:|.||.|...||.||.:|||:
Mouse   142 FNDETCLMMINMFDKTKSGRIDVAGFSALWKFLQQWRNLFQQYDRDRSGSISSTELQQALSQMGY 206

  Fly   132 RFSPEFINFLVKKSDPQGH-KEVSVDQFIVLCVQVQRFTEAFRQRDTQQNGTITIGFEDFLTV 193
            ..||:|...||.:...:.. ..:.:|.||.:|.|:|..|||||::||...|.|.:.||||:|:
Mouse   207 NLSPQFTQLLVSRYCARSAIPAMQLDCFIKVCTQLQVLTEAFREKDTAVQGNIRLSFEDFVTM 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17765NP_610592.1 FRQ1 26..162 CDD:227455 56/136 (41%)
EFh 39..92 CDD:238008 25/52 (48%)
EFh 105..159 CDD:298682 20/54 (37%)
Pef1NP_080717.2 8 X 9 AA approximate tandem repeat of [AP]-P-G-G-P-Y-G-G-P-P 21..100 9/19 (47%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 21..45
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 59..103 9/22 (41%)
EFh 114..172 CDD:238008 27/57 (47%)
EF-hand_7 114..170 CDD:290234 26/55 (47%)
EF-hand_6 176..205 CDD:290141 14/28 (50%)
EF-hand_7 178..269 CDD:290234 38/90 (42%)
EFh 178..269 CDD:298682 38/90 (42%)
Required for interaction with PDCD6. /evidence=ECO:0000250|UniProtKB:Q9UBV8 195..275 32/75 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 59 1.000 Domainoid score I10701
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H56569
Inparanoid 1 1.050 157 1.000 Inparanoid score I4270
Isobase 1 0.950 - 0 Normalized mean entropy S1970
OMA 1 1.010 - - QHG54126
OrthoDB 1 1.010 - - D1330600at2759
OrthoFinder 1 1.000 - - FOG0000697
OrthoInspector 1 1.000 - - oto92268
orthoMCL 1 0.900 - - OOG6_100410
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2225
SonicParanoid 1 1.000 - - X1327
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1413.860

Return to query results.
Submit another query.